PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00174.1.g00600.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family G2-like
Protein Properties Length: 273aa    MW: 30676.8 Da    PI: 6.8594
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00174.1.g00600.1.sm.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like64.81.5e-2089140355
                       G2-like   3 rlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                   rl Wt eL e+F+ea+e L G ++A+P++i++ m+vk+Lt ++++SHLQk+R+
  Zpz_sc00174.1.g00600.1.sm.mk  89 RLIWTVELQEKFLEAIEVL-GDKNAVPSRIVKQMNVKDLTAKQIASHLQKHRS 140
                                   99*****************.9******************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.95584143IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.4E-1985143IPR009057Homeodomain-like
SuperFamilySSF466893.05E-1588143IPR009057Homeodomain-like
TIGRFAMsTIGR015572.8E-1989141IPR006447Myb domain, plants
PfamPF002495.4E-792139IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
MQISYGVVSQ CGIVSKAMYA NDNEEASSEC MAVGACFHLP KPLTAGSFNM LRDTARQHKS  60
RRAAIKQQHL KGHTNSTKRD RFHSKKLDRL IWTVELQEKF LEAIEVLGDK NAVPSRIVKQ  120
MNVKDLTAKQ IASHLQKHRS RVKAYQRKFQ QNASKKAVPE LIRSEHNEST TVDEAWNEAL  180
VWGTQPSLVN IIEPITQETI VEETLVPDPV MQSAQTQEAA VGDAQVPDPV VQFVQTQEVA  240
VGAAPLHDHV MQFTQDDVYW SLSPSLADYD MLF
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc00174.1.g00600.1.sm.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014660566.24e-33uncharacterized protein LOC101775816 isoform X2
TrEMBLA0A368QZ019e-32A0A368QZ01_SETIT; Uncharacterized protein
STRINGPavir.Db00207.1.p4e-32(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP130171928
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44190.11e-13GOLDEN2-like 2