PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00165.1.g00220.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRAS
Protein Properties Length: 597aa    MW: 63991.8 Da    PI: 6.0647
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00165.1.g00220.1.sm.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS390.51.9e-1192005674374
                          GRAS   4 lLlecAeavssgdlelaqalLarlselaspdg.dpmqRlaayfteALaarlarsvselykalppsetsekn.sseelaalk 82 
                                   +L++cA+ +++ d+++a+ +Larl e+asp+g +pm+R+aayf+eALa r++r++++l++  pp+e ++    ++ ++al+
  Zpz_sc00165.1.g00220.1.sm.mk 200 ALTACADSLATCDQHAADYYLARLGEMASPAGpTPMHRVAAYFAEALAIRVVRMWPHLFDVTPPRELTDGAiDDDDAMALR 280
                                   79*****************************************************************9888788999**** PP

                          GRAS  83 lfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetge 163
                                   +++ v+Pi++f h+t N+ +l+a+eg++rvH+iDfdi+qGlQWp Llq+La+R+++p+++RiTgvg+    s++el+etg 
  Zpz_sc00165.1.g00220.1.sm.mk 281 ILNAVTPIPRFLHFTLNERLLRAFEGHDRVHVIDFDIKQGLQWPGLLQSLAARASPPAHVRITGVGE----SRQELQETGA 357
                                   *******************************************************************....9********* PP

                          GRAS 164 rLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveq 244
                                   rL+++A++lg+ fef++ v++rled++l++L+vk+gE++aVn+vl +hrll+++   +    ++L lv+s+ + ++ + e+
  Zpz_sc00165.1.g00220.1.sm.mk 358 RLEHVAASLGLAFEFHA-VVDRLEDVRLWMLHVKRGECVAVNCVLTVHRLLRDESGAS--LADFLGLVRSTGAAILLLGEH 435
                                   *****************.7********************************6554444..589****************** PP

                          GRAS 245 eadhnsesFlerflealeyysalfdsl.eaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGF 324
                                   e  +ns+++ +rf++al+yy+a fd++ +a+l+ +s +r+k E++ ++rei+n+va eg++r+erh t++ Wr+r+e++GF
  Zpz_sc00165.1.g00220.1.sm.mk 436 EDALNSGRWEARFARALRYYAAAFDAVdAAGLAYASPARTKAEEM-FAREIRNAVAFEGTDRFERHDTFGGWRRRMEDCGF 515
                                   ***************************9999**************.*********************************** PP

                          GRAS 325 kpvplsekaakqaklllrkvksdgyrveee..sgslvlgWkdrpLvsvSaWr 374
                                   k++ +++++a+q +l+ r+++   yrv+ +   ++l+l W ++++++vSaW+
  Zpz_sc00165.1.g00220.1.sm.mk 516 KNAGIGDREAMQGRLISRMFAPGNYRVQAQgdGEALTLQWLNQAMYTVSAWT 567
                                   *********************555***9654256677**************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098555.124171545IPR005202Transcription factor GRAS
PfamPF035146.4E-117200567IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 597 aa     Download sequence    Send to blast
MEVSACRSLG LAAVRALRHG ILSLVQAGGG NCSFRAHPAP VTQAVSWGAK QEPSGNVAGG  60
FWERSRAVKR AHEEDAVEEY GGPTVRAKRT RMGGDGDEVW FHQSIAGTVQ QAAPGEGEES  120
EEEKVFLVPS AATFPHGMAA AGPSLAAAKQ EFSNSPSPAS SGGTDGGGTS AVPPPPEVHA  180
RNGMPAHGEA GRETMELLGA LTACADSLAT CDQHAADYYL ARLGEMASPA GPTPMHRVAA  240
YFAEALAIRV VRMWPHLFDV TPPRELTDGA IDDDDAMALR ILNAVTPIPR FLHFTLNERL  300
LRAFEGHDRV HVIDFDIKQG LQWPGLLQSL AARASPPAHV RITGVGESRQ ELQETGARLE  360
HVAASLGLAF EFHAVVDRLE DVRLWMLHVK RGECVAVNCV LTVHRLLRDE SGASLADFLG  420
LVRSTGAAIL LLGEHEDALN SGRWEARFAR ALRYYAAAFD AVDAAGLAYA SPARTKAEEM  480
FAREIRNAVA FEGTDRFERH DTFGGWRRRM EDCGFKNAGI GDREAMQGRL ISRMFAPGNY  540
RVQAQGDGEA LTLQWLNQAM YTVSAWTPAS DGDAGGSTVS ASLSVSVSTT ASHSQQS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-421975664374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004964401.10.0PREDICTED: scarecrow-like protein 28
TrEMBLK3Y2010.0K3Y201_SETIT; Uncharacterized protein
STRINGSi008220m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64043455
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G63100.11e-127GRAS family protein