PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00165.1.g00220.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRAS
Protein Properties Length: 597aa    MW: 63991.8 Da    PI: 6.0647
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00165.1.g00220.1.sm.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS390.51.9e-1192005674374
                          GRAS   4 lLlecAeavssgdlelaqalLarlselaspdg.dpmqRlaayfteALaarlarsvselykalppsetsekn.sseelaalk 82 
                                   +L++cA+ +++ d+++a+ +Larl e+asp+g +pm+R+aayf+eALa r++r++++l++  pp+e ++    ++ ++al+
  Zpz_sc00165.1.g00220.1.sm.mk 200 ALTACADSLATCDQHAADYYLARLGEMASPAGpTPMHRVAAYFAEALAIRVVRMWPHLFDVTPPRELTDGAiDDDDAMALR 280
                                   79*****************************************************************9888788999**** PP

                          GRAS  83 lfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetge 163
                                   +++ v+Pi++f h+t N+ +l+a+eg++rvH+iDfdi+qGlQWp Llq+La+R+++p+++RiTgvg+    s++el+etg 
  Zpz_sc00165.1.g00220.1.sm.mk 281 ILNAVTPIPRFLHFTLNERLLRAFEGHDRVHVIDFDIKQGLQWPGLLQSLAARASPPAHVRITGVGE----SRQELQETGA 357
                                   *******************************************************************....9********* PP

                          GRAS 164 rLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveq 244
                                   rL+++A++lg+ fef++ v++rled++l++L+vk+gE++aVn+vl +hrll+++   +    ++L lv+s+ + ++ + e+
  Zpz_sc00165.1.g00220.1.sm.mk 358 RLEHVAASLGLAFEFHA-VVDRLEDVRLWMLHVKRGECVAVNCVLTVHRLLRDESGAS--LADFLGLVRSTGAAILLLGEH 435
                                   *****************.7********************************6554444..589****************** PP

                          GRAS 245 eadhnsesFlerflealeyysalfdsl.eaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGF 324
                                   e  +ns+++ +rf++al+yy+a fd++ +a+l+ +s +r+k E++ ++rei+n+va eg++r+erh t++ Wr+r+e++GF
  Zpz_sc00165.1.g00220.1.sm.mk 436 EDALNSGRWEARFARALRYYAAAFDAVdAAGLAYASPARTKAEEM-FAREIRNAVAFEGTDRFERHDTFGGWRRRMEDCGF 515
                                   ***************************9999**************.*********************************** PP

                          GRAS 325 kpvplsekaakqaklllrkvksdgyrveee..sgslvlgWkdrpLvsvSaWr 374
                                   k++ +++++a+q +l+ r+++   yrv+ +   ++l+l W ++++++vSaW+
  Zpz_sc00165.1.g00220.1.sm.mk 516 KNAGIGDREAMQGRLISRMFAPGNYRVQAQgdGEALTLQWLNQAMYTVSAWT 567
                                   *********************555***9654256677**************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098555.124171545IPR005202Transcription factor GRAS
PfamPF035146.4E-117200567IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 597 aa     Download sequence    Send to blast
MEVSACRSLG LAAVRALRHG ILSLVQAGGG NCSFRAHPAP VTQAVSWGAK QEPSGNVAGG  60
FWERSRAVKR AHEEDAVEEY GGPTVRAKRT RMGGDGDEVW FHQSIAGTVQ QAAPGEGEES  120
EEEKVFLVPS AATFPHGMAA AGPSLAAAKQ EFSNSPSPAS SGGTDGGGTS AVPPPPEVHA  180
RNGMPAHGEA GRETMELLGA LTACADSLAT CDQHAADYYL ARLGEMASPA GPTPMHRVAA  240
YFAEALAIRV VRMWPHLFDV TPPRELTDGA IDDDDAMALR ILNAVTPIPR FLHFTLNERL  300
LRAFEGHDRV HVIDFDIKQG LQWPGLLQSL AARASPPAHV RITGVGESRQ ELQETGARLE  360
HVAASLGLAF EFHAVVDRLE DVRLWMLHVK RGECVAVNCV LTVHRLLRDE SGASLADFLG  420
LVRSTGAAIL LLGEHEDALN SGRWEARFAR ALRYYAAAFD AVDAAGLAYA SPARTKAEEM  480
FAREIRNAVA FEGTDRFERH DTFGGWRRRM EDCGFKNAGI GDREAMQGRL ISRMFAPGNY  540
RVQAQGDGEA LTLQWLNQAM YTVSAWTPAS DGDAGGSTVS ASLSVSVSTT ASHSQQS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A2e-6020457026382Protein SCARECROW
5b3h_A2e-6020457025381Protein SCARECROW
5b3h_D2e-6020457025381Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that acts as positivie regulator of brassinosteroid (BR) signaling (PubMed:19220793, PubMed:22685166). Functions downstream of BRI1 and GSK2 to modulate BR responses. Acts as a direct target of GSK2 kinase to mediate BR responses (PubMed:22685166). Involved in feedback inhibition of BR biosynthetic genes. Repressed by BZR1 (PubMed:19220793). {ECO:0000269|PubMed:19220793, ECO:0000269|PubMed:22685166}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc00165.1.g00220.1.sm.mk
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Down-regulated by 24-epibrassinolide. {ECO:0000269|PubMed:19220793}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004964401.10.0protein DWARF AND LOW-TILLERING
SwissprotQ9LWU90.0DLT_ORYSJ; Protein DWARF AND LOW-TILLERING
TrEMBLA0A1E5WNH30.0A0A1E5WNH3_9POAL; Scarecrow-like protein 28
STRINGSi008220m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64043455
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G63100.11e-127GRAS family protein
Publications ? help Back to Top
  1. Tong H,Chu C
    Roles of DLT in fine modulation on brassinosteroid response in rice.
    Plant Signal Behav, 2009. 4(5): p. 438-9
    [PMID:19816111]
  2. Li W, et al.
    Identification and characterization of dwarf 62, a loss-of-function mutation in DLT/OsGRAS-32 affecting gibberellin metabolism in rice.
    Planta, 2010. 232(6): p. 1383-96
    [PMID:20830595]
  3. Tong H, et al.
    DWARF AND LOW-TILLERING acts as a direct downstream target of a GSK3/SHAGGY-like kinase to mediate brassinosteroid responses in rice.
    Plant Cell, 2012. 24(6): p. 2562-77
    [PMID:22685166]
  4. Zhang C,Bai MY,Chong K
    Brassinosteroid-mediated regulation of agronomic traits in rice.
    Plant Cell Rep., 2014. 33(5): p. 683-96
    [PMID:24667992]
  5. Yang C,Shen W,He Y,Tian Z,Li J
    OVATE Family Protein 8 Positively Mediates Brassinosteroid Signaling through Interacting with the GSK3-like Kinase in Rice.
    PLoS Genet., 2016. 12(6): p. e1006118
    [PMID:27332964]