PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00158.1.g00400.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 295aa    MW: 31346.2 Da    PI: 7.261
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00158.1.g00400.1.sm.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1191.8e-372884662
                        zf-Dof  6 lkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                                   +cprC s ntkfCyynnyslsqPryfCk+CrryWtkGG+lrnvPvGgg+rkn++++
  Zpz_sc00158.1.g00400.1.sm.mk 28 PSCPRCGSPNTKFCYYNNYSLSQPRYFCKGCRRYWTKGGSLRNVPVGGGCRKNRREK 84
                                  58***************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-291482IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.6582882IPR003851Zinc finger, Dof-type
PfamPF027011.9E-312982IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103066IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MLPPYPAGGR RAVLLDHRRY RPNVEVAPSC PRCGSPNTKF CYYNNYSLSQ PRYFCKGCRR  60
YWTKGGSLRN VPVGGGCRKN RREKSARSLA AGGGAATFSH RFPGALRPDL LLEGMAGSPA  120
GIGGSQPVSA DKPGVADGSA IDLALLYAKF LNPNAVQCPV VKESADMTSG SSSDMSPNAA  180
PQPDQPFSSQ DAFGNNLPVP SSTEPSAEPT LPLPDSRTEA LGDLSFSVDQ SCYQALGLPT  240
DSGELILPST WRHEAKYEPF DPLPAMSLHD SITGADDVWT NAPACQGLEA ALCRP
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00405DAPTransfer from AT3G52440Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc00158.1.g00400.1.sm.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0872621e-97BT087262.1 Zea mays full-length cDNA clone ZM_BFb0021J09 mRNA, complete cds.
GenBankEU9665491e-97EU966549.1 Zea mays clone 295206 dof domain, zinc finger family protein mRNA, complete cds.
GenBankJX4284771e-97JX428477.1 Zea mays subsp. mays clone pUT3073 DOF20 C2C2-DOF type transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004961942.11e-123dof zinc finger protein DOF1.8
SwissprotQ9SVC51e-39DOF35_ARATH; Dof zinc finger protein DOF3.5
TrEMBLA0A1D8F0J01e-128A0A1D8F0J0_9POAL; Dof protein
STRINGSi022633m1e-122(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26593683
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52440.12e-41Dof family protein