PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00150.1.g00320.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GeBP
Protein Properties Length: 361aa    MW: 39258.8 Da    PI: 7.2237
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00150.1.g00320.1.sm.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57386.43.7e-2772166297
                        DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfsk 82 
                                   +fqr+wse+De+ +LqGl+ +   +g     d++ fy+ +++s+   +++sql+eK+rrLK+Kf+ +++++++g +p+  +
  Zpz_sc00150.1.g00320.1.sm.mk  72 KFQRIWSESDELRFLQGLLGC-GAQGLVFPRDLNVFYDRFSESMPQPYTRSQLSEKLRRLKNKFRSMSARVAKGLDPARLA 151
                                   79*******************.556878888************************************************** PP

                        DUF573  83 ehdqkifelskkiWg 97 
                                   +hd+++++l++++W+
  Zpz_sc00150.1.g00320.1.sm.mk 152 PHDRDVLHLCSRLWD 166
                                   **************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045041.2E-2473166IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 361 aa     Download sequence    Send to blast
MASEDQQTLP VPVPVPPNPT ATPTAPADPT APSGARKLPI KRRSPRPSSS SPPSSGSDQQ  60
QEQEQEPQPP FKFQRIWSES DELRFLQGLL GCGAQGLVFP RDLNVFYDRF SESMPQPYTR  120
SQLSEKLRRL KNKFRSMSAR VAKGLDPARL APHDRDVLHL CSRLWDPANA ATSPFAASAG  180
TGASGNRRRR ANPHGTLQSP DAPGDSNTNR FNGISFPDGS NCEDMFFIEQ ESGHLGNHEG  240
ASLVADSTFS GIALEQPQTT AAVPIGDHGL VSEMNGNHKL VVPCSSEHRM ANAVLDVFEE  300
CLREAKANGI FRGGNAKGSA SESELTKRWR AQRMDELDVL NRRLRLLVED TAAAGNMPSS  360
L
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0352841e-133BT035284.1 Zea mays full-length cDNA clone ZM_BFb0053D22 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001143574.21e-165uncharacterized protein LOC100276272
TrEMBLF1DK221e-166F1DK22_MAIZE; GEBP transcription factor (Fragment)
STRINGGRMZM2G041818_P011e-165(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP86953243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04930.17e-11DNA-binding storekeeper protein-related transcriptional regulator