PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00143.1.g00510.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRAS
Protein Properties Length: 678aa    MW: 72740.8 Da    PI: 5.8288
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00143.1.g00510.1.sm.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS382.84.2e-1172816502374
                          GRAS   2 velLlecAeavssgdlelaqalLarlselaspdg.dpmqRlaayfteALaarlarsvselykalppsetsekn.sseelaa 80 
                                   v +L++cA+ +++ d+++a+ +Larl  +asp+g +pm+R+aayf+eALa r++r++++l++  pp+e ++    ++ + a
  Zpz_sc00143.1.g00510.1.sm.mk 281 VGALTACADSLAAYDHQAANYYLARLGMIASPAGpTPMHRVAAYFAEALAIRVVRTWPHLFDVTPPRELTDGAvGDDDAVA 361
                                   678*****************************************************************998887899999* PP

                          GRAS  81 lklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleet 161
                                   l++++ ++Pi++f h+t N+ +l+a++g++rvH+iDfdi+qGlQWp Llq+La+R+++p ++RiTgvg+    sk+el+ t
  Zpz_sc00143.1.g00510.1.sm.mk 362 LRVLNAITPIPRFLHFTINERLLRAFDGHDRVHVIDFDIKQGLQWPGLLQSLAARANPPSHVRITGVGE----SKQELQDT 438
                                   *********************************************************************....******** PP

                          GRAS 162 gerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvv 242
                                   g rL ++A++lg+ fef++ v++rled++l++L+vk gE++aVn+vl++hrll ++  +  +  ++L l +s+ + ++ + 
  Zpz_sc00143.1.g00510.1.sm.mk 439 GARLGHVAASLGLAFEFHA-VVDRLEDVRLWMLHVKGGECVAVNCVLAVHRLLCNENGT--ALADFLGLARSTGAAILLLG 516
                                   *******************.7*******************************9554444..4589**************** PP

                          GRAS 243 eqeadhnsesFlerflealeyysalfdsl.eaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleea 322
                                   e+e+ +ns+++ +rf+ al+yy+a fd++ +a+l+ +s +r+kvE++ ++rei+++va ega+r erhet++ Wr+ +ee+
  Zpz_sc00143.1.g00510.1.sm.mk 517 EREVALNSGRWEARFACALRYYAAAFDAVdAAGLAYTSLARAKVEEM-FAREIRSAVAFEGADRLERHETFAGWRRLMEEC 596
                                   *****************************9999**************.********************************* PP

                          GRAS 323 GFkpvplsekaakqaklllrkvksdgyrveee..sgslvlgWkdrpLvsvSaWr 374
                                   GFk++ l++++a+q +++ r+++ + y+v+ +   ++l+l W ++++++vSaW+
  Zpz_sc00143.1.g00510.1.sm.mk 597 GFKNAGLGDREAMQGRMITRMFAPRNYSVQAQgdGEALTLQWLNQAMYTVSAWT 650
                                   ***********************888***9654256677**************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098553.945254628IPR005202Transcription factor GRAS
PfamPF035141.5E-114281650IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 678 aa     Download sequence    Send to blast
MELSTCRSLG LAVDAVRALR SGMVAALQQE EDEEEGTEEE ERSGSLPGTS HPAVSRISRM  60
LAGCSFTSSR HHMSTTQRFD ILQCGLSKRS NRGGDGAAAQ RVAAADARTG GATCSFRAHP  120
APPVAQAVSW GAKPEPSGNV AGGGVWERSR AVKRAHEEDV VEEYGGPTVR AKRTRMGSEG  180
DEVWFRQPIA GTVQQAAPGE GEEGDEEKVF LVPSAAAFPH GMAAAGPSMT AAKQEEFSNS  240
PSPASSVGTD GGSSAVPPPD VHARNGVPLT GEVAREAMEL VGALTACADS LAAYDHQAAN  300
YYLARLGMIA SPAGPTPMHR VAAYFAEALA IRVVRTWPHL FDVTPPRELT DGAVGDDDAV  360
ALRVLNAITP IPRFLHFTIN ERLLRAFDGH DRVHVIDFDI KQGLQWPGLL QSLAARANPP  420
SHVRITGVGE SKQELQDTGA RLGHVAASLG LAFEFHAVVD RLEDVRLWML HVKGGECVAV  480
NCVLAVHRLL CNENGTALAD FLGLARSTGA AILLLGEREV ALNSGRWEAR FACALRYYAA  540
AFDAVDAAGL AYTSLARAKV EEMFAREIRS AVAFEGADRL ERHETFAGWR RLMEECGFKN  600
AGLGDREAMQ GRMITRMFAP RNYSVQAQGD GEALTLQWLN QAMYTVSAWT PRPTAAQEEA  660
RLSEEERTGF FSGSFALS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-432806494374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004964401.10.0PREDICTED: scarecrow-like protein 28
TrEMBLK3Y2010.0K3Y201_SETIT; Uncharacterized protein
STRINGSi008220m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64043455
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G63100.11e-126GRAS family protein