PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00143.1.g00260.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRF
Protein Properties Length: 392aa    MW: 42583.4 Da    PI: 9.1868
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00143.1.g00260.1.sm.mkhcgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC77.11.7e-2493137145
                             WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                                     d+ep+rCrRtDGKkWRCs+++ +++k+CErH+hrgr+rsrk++e+
  Zpz_sc00143.1.g00260.1.sm.mkhc  93 DPEPWRCRRTDGKKWRCSKEAHPDSKYCERHMHRGRNRSRKPVES 137
                                     79****************************************986 PP

2QLQ62.79.6e-222357236
                             QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36
                                     FTaaQ+++L++Q+l+yKyL+a++PvPp+Ll++i+
  Zpz_sc00143.1.g00260.1.sm.mkhc 23 VFTAAQWAELEQQALIYKYLMAGVPVPPDLLLPIR 57
                                    5********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009515.4E-122258IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166623.4682358IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088804.4E-162457IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166726.34693137IPR014977WRC domain
PfamPF088794.7E-2194136IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 392 aa     Download sequence    Send to blast
MLSSAAMGMG GFPHQQQPRG AAVFTAAQWA ELEQQALIYK YLMAGVPVPP DLLLPIRPHS  60
AAAFSFGPAI GAASSFYHHP SLSYYAYYGK KLDPEPWRCR RTDGKKWRCS KEAHPDSKYC  120
ERHMHRGRNR SRKPVESKSA SPAHQSQPQL STVTNATRDT QPLQSLAMGA KTHGLSLGGA  180
GSSQLQVDAS SYGSKFSLGG KADVGELSFL SGASGNSRGF TIDSSSDSSW HSLSSNVPPF  240
TLSTTRESGL LSGAYNYSNL EPSQELGQVT IASLSQDQER HSFNSGTGGL MKQENQSLRP  300
FFDEWPATRD SWSEVDDART EESLHVSLSS RAQLTRMAWK PAAAFELKNI VIGDNKMLHA  360
VGQLLAVSSV EKGTGAGNQQ AIQVQDINKQ YR
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that plays a regulatory role in gibberellin-induced stem elongation. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc00143.1.g00260.1.sm.mkhc
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015641602.11e-175growth-regulating factor 5 isoform X1
RefseqXP_015641605.11e-175growth-regulating factor 5 isoform X4
SwissprotQ6AWY41e-176GRF5_ORYSJ; Growth-regulating factor 5
TrEMBLA0A0A9F0Q10.0A0A0A9F0Q1_ARUDO; Uncharacterized protein
STRINGORGLA06G0010200.11e-173(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP110462431
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.12e-31growth-regulating factor 5
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]