PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00119.1.g00380.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family ZF-HD
Protein Properties Length: 605aa    MW: 64789.8 Da    PI: 7.8616
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00119.1.g00380.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer96.32.4e-30369421558
                   ZF-HD_dimer   5 rYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 
                                   rY+eClkNhA  +GghavDGCgEfm++ geegt +al+CaAC+CHRnFHR+e+ 
  Zpz_sc00119.1.g00380.1.am.mk 369 RYRECLKNHALGIGGHAVDGCGEFMAA-GEEGTLDALRCAACNCHRNFHRKESP 421
                                   8*************************9.999********************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257749.0E-24369422IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047702.6E-28369420IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.8E-28369419IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.647370419IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466896.72E-19503576IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.4E-32505577IPR009057Homeodomain-like
TIGRFAMsTIGR015655.5E-25515571IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 605 aa     Download sequence    Send to blast
MPSAACDELT ATCSAPLTQR RFVHDLQARP NCEPFRWRFP GGAAPPPAID LIPYEIPRQW  60
QGCGCAALLF SSTLVAPAHL LLLPCSGSPQ PSKLDQRCGC LRPFSAFCCP PLLLGWPFRC  120
CGVRMDSDEH NGCRPVHSKS TPTKIRRGIA TERNRLQSTY ATHGPPLATD GDLRSGLNTC  180
FGCETPGCTD GVVMQNGPGL RTPEAYCPEP RALDRGAPGR DKTAAGTASA RRGEVACLRA  240
PISDAFLFRW GDWTVDNTVN WTERTAVEAL PAKIGPEHAG RSRDQTRGTA SSSPLPLLKQ  300
RDTRNTCLPA MDFDDHDDGD EEMAPLPPVL SSSYETPPPQ SSGFGGGVAP AKPPSEPGSS  360
AKAPGGGGRY RECLKNHALG IGGHAVDGCG EFMAAGEEGT LDALRCAACN CHRNFHRKES  420
PTAEGSPVSP AAIVAYGATP HQQFSPFYRT PADYFHHQPH YMAPRPLALP STSHSGRDDG  480
DDLSGMAGHV SALGQMSGMS LGAGPSGSGG SGSGKKRFRT KFAQEQKDRM LAFAERVGWR  540
IQKHDEAAVQ QFCDEVGVKR HVLKVWMHNN KHTLGKKPQH AAHPDPDPHC AHAPLNNAHA  600
PSQSN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A9e-275165731875ZF-HD homeobox family protein
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc00119.1.g00380.1.am.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126171e-101CP012617.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 9 sequence.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP39503269
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.11e-56homeobox protein 22