PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00110.1.g00270.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family ZF-HD
Protein Properties Length: 396aa    MW: 43266.4 Da    PI: 8.1099
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00110.1.g00270.1.sm.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer88.56.6e-28147200358
                   ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 
                                   ++rY+eC++NhAa++G+h++DGCgEfmps  e   +  l CaACgCHR+FHRre +
  Zpz_sc00110.1.g00270.1.sm.mk 147 QCRYRECQRNHAAKMGAHVLDGCGEFMPSAYE--GPGLLACAACGCHRSFHRREAV 200
                                   79**************************9444..5999***************986 PP

2Homeobox15.62.8e-05293348152
                                   TT--SS--HHHHHHHHHHHH....HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHH CS
                      Homeobox   1 rrkRttftkeqleeLeelFe....knrypsaeereeLAkklgLterqVkvWFqNrR 52 
                                   +r Rt+ft+eq +++ e+ +    + ++p+ e+     +++g++ r+ kvW +N +
  Zpz_sc00110.1.g00270.1.sm.mk 293 KRFRTKFTAEQKDRMREFAHrvgwRIHKPDSEAVDVFCAQVGVSRRVLKVWMHNNK 348
                                   789***********987655888779****************************88 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257741.0E-15144198IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047703.9E-24148199IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.2E-24149198IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152324.677150198IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.601.1E-29284351IPR009057Homeodomain-like
SuperFamilySSF466892.39E-19285349IPR009057Homeodomain-like
TIGRFAMsTIGR015654.7E-27292348IPR006455Homeodomain, ZF-HD class
CDDcd000860.0064293346No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 396 aa     Download sequence    Send to blast
MEYNRSSHVE EEEEEDDLDE EEEEYDDHRY TTAPAAPVGA PLQQLVPGQH HGPVGSRSSM  60
MDSAAAAFSR PFLPPNSSLV SQVPLPPGFL QAHRQHPQAH PRRRERAVGT QHRHLRCEQA  120
RNGATSLPVS TLAVTTGGVA MGAEPTQCRY RECQRNHAAK MGAHVLDGCG EFMPSAYEGP  180
GLLACAACGC HRSFHRREAV HGVAAAAALS PIAAATPNAY SSGRVIPLLL APPRMQTRPH  240
VPASPSSAPA SLTESSSEEL RGPAPARPHP PAPTSMHQLT VGSASAPPAP SKKRFRTKFT  300
AEQKDRMREF AHRVGWRIHK PDSEAVDVFC AQVGVSRRVL KVWMHNNKHL AKITPQSTSS  360
QQPTPTMPPP QQHHHQDDHH YPLLPPPHQQ QQPQND
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A2e-212913491674ZF-HD homeobox family protein
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc00110.1.g00270.1.sm.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025826471.11e-102zinc-finger homeodomain protein 7-like
SwissprotQ8S3Q92e-70ZHD7_ORYSJ; Zinc-finger homeodomain protein 7
TrEMBLA0A0A8Y4W61e-106A0A0A8Y4W6_ARUDO; Uncharacterized protein
STRINGGRMZM2G069365_P011e-100(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP134912329
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15210.14e-36homeobox protein 30