PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00110.1.g00170.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 431aa    MW: 46237.6 Da    PI: 10.4698
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00110.1.g00170.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.41.8e-39192251261
                        zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                                   +++ lkcprC+st+tkfCyynnyslsqPryfCk+CrryWtkGG+lrnvPvGgg+rknk++
  Zpz_sc00110.1.g00170.1.am.mk 192 HDQPLKCPRCESTHTKFCYYNNYSLSQPRYFCKTCRRYWTKGGSLRNVPVGGGCRKNKRT 251
                                   7899******************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-31190250IPR003851Zinc finger, Dof-type
PfamPF027016.9E-33193250IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.227196250IPR003851Zinc finger, Dof-type
PROSITE patternPS013610198234IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010067Biological Processprocambium histogenesis
GO:0010087Biological Processphloem or xylem histogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 431 aa     Download sequence    Send to blast
MRASGGGRAG PKEPNQKPTR TGEGDGHGGP RMQARTTLLL RYASTATYIG ITRHAAAPLD  60
RSTRGANLFR PFLFTSPLHP RRRPHRTPTT TTTTSSASFR LAASSLQFFS SAPKSISLNI  120
RRRIEHRLTT KVDRSMMAGA PPMHICMDSD WFKGIVPEEP GMGSSSPSTE LIACPRQMHP  180
AAAADRRLRP QHDQPLKCPR CESTHTKFCY YNNYSLSQPR YFCKTCRRYW TKGGSLRNVP  240
VGGGCRKNKR TGAKKPAAPQ LQAHARHMAE TGLHLSFSSS GMQQLLPPPA AADPLCSLGL  300
LDWKYDPILM GSAGGAAALE GASSEAHFTG PGMMGMPGVG GECHALSALR YAAGLGDHLQ  360
APPPPFGSSR AEHNGVEVKP AAAERLLSLE WYGAEASRAP ESTISSFGAL GLWSGMLGGA  420
HQQHHGSSTA I
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00580DAPTransfer from AT5G62940Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc00110.1.g00170.1.am.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004953626.11e-164dof zinc finger protein 1
TrEMBLK3YUL61e-163K3YUL6_SETIT; Uncharacterized protein
STRINGSi017962m1e-164(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47043263
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62940.17e-38Dof family protein