PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00105.1.g00090.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRF
Protein Properties Length: 256aa    MW: 27255.4 Da    PI: 4.5227
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00105.1.g00090.1.sm.mkhcgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC69.44.3e-22174214141
                             WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrk 41 
                                     ++epgrCrRtDGKkWRC+r +++++k+C+rH+hrgr+r  +
  Zpz_sc00105.1.g00090.1.sm.mkhc 174 EPEPGRCRRTDGKKWRCWRSTIPNEKYCQRHMHRGRKRPVQ 214
                                     69***********************************9876 PP

2QLQ52.91.1e-18108143237
                             QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                                      FTa+Qlq+L++Q  +y+y+aa++PvP +L+++i+k
  Zpz_sc00105.1.g00090.1.sm.mkhc 108 LFTAMQLQELEQQSRVYQYMAARVPVPTHLVFPIWK 143
                                     6*********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.0E-7107143IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166620.602108143IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.3E-11109142IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166721.366174218IPR014977WRC domain
PfamPF088791.1E-18175213IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MTAEGDTLNP VGGGGGGDNY PQEAAAAAAE EAAQAAVAQG AGHEPVEELA SREGAGAGED  60
DVACRDLVLI EDPEAVAVED PEEATAAAAL QEEMKALIAS IPDGAGALFT AMQLQELEQQ  120
SRVYQYMAAR VPVPTHLVFP IWKSVTGASF EGAQKYPTLM GLATLCLDFG KDPEPEPGRC  180
RRTDGKKWRC WRSTIPNEKY CQRHMHRGRK RPVQLVFEDD EPDSASGSKT TPGKADDKNA  240
SNKKLTVAAR AAMEST
Functional Description ? help Back to Top
Source Description
UniProtInvolved in the regulation of cell proliferation in developing shoots and leaves (PubMed:24854713). Does not possess transactivation activity (PubMed:24854713). {ECO:0000269|PubMed:24854713}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc00105.1.g00090.1.sm.mkhc
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004957654.11e-135growth-regulating factor 11
SwissprotA5HEG91e-134GRF10_MAIZE; GRF-interacting factor 10
TrEMBLK3ZW281e-133K3ZW28_SETIT; Uncharacterized protein
STRINGSi030809m1e-134(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP67353152
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37740.12e-30growth-regulating factor 2
Publications ? help Back to Top
  1. Soderlund C, et al.
    Sequencing, mapping, and analysis of 27,455 maize full-length cDNAs.
    PLoS Genet., 2009. 5(11): p. e1000740
    [PMID:19936069]
  2. Schnable PS, et al.
    The B73 maize genome: complexity, diversity, and dynamics.
    Science, 2009. 326(5956): p. 1112-5
    [PMID:19965430]
  3. Zhang D, et al.
    GRF-interacting factor1 Regulates Shoot Architecture and Meristem Determinacy in Maize.
    Plant Cell, 2018. 30(2): p. 360-374
    [PMID:29437990]