PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00103.1.g00700.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family LBD
Protein Properties Length: 797aa    MW: 86053.2 Da    PI: 11.8458
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00103.1.g00700.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260125.82.1e-3995193199
                        DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvil 81 
                                   +CaaCk+lrr+Ca++C++apyf  ++p+kf +vhk+FGasnv+k+l ++pe er da+ slvyeA+ r+rdPvyG++g i+
  Zpz_sc00103.1.g00700.1.am.mk  95 PCAACKLLRRRCAQECPFAPYFSPHEPQKFVAVHKVFGASNVSKMLLEVPEAERGDAVGSLVYEANLRLRDPVYGCMGAIS 175
                                   7******************************************************************************** PP

                        DUF260  82 klqqqleqlkaelallke 99 
                                   +lqqql+ l+ael++ +e
  Zpz_sc00103.1.g00700.1.am.mk 176 DLQQQLNALEAELEADEE 193
                                   ************998665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.46294195IPR004883Lateral organ boundaries, LOB
PfamPF031951.4E-3995190IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 797 aa     Download sequence    Send to blast
MNPHQTAVLI NEGGGGASAG VGGGRSRQET ARATSTGNGA RAVSDGTGER LDEIRKKIKG  60
EPEASGITPS ASTVAAETPV PRRLGLGGAL NTVTPCAACK LLRRRCAQEC PFAPYFSPHE  120
PQKFVAVHKV FGASNVSKML LEVPEAERGD AVGSLVYEAN LRLRDPVYGC MGAISDLQQQ  180
LNALEAELEA DEEERRGLFH GVACGVSMQL RSSSWLSSNS GILHPRDFSL SEASCLDERG  240
MARRGRVGGM VPRSPWGGHR NAAGSGPQRM VLASDGGHLA RCHASRHPLV CPETGVQSLR  300
ACVLIISSMC MLIRAGPANP LPYLPDQSRH AVERAETRTP NTAASDAGVA SGRRHRARRG  360
PHDRCRGTSA SASSNSLLRP KRLTWCQQGS TPAGFGSPCA WAVERMALMI GRRRRGPAAS  420
ARERNEARRV TGPPIHQRGG PPRRDCRLKR RRGRQERSRV TAGSVQDRRP GYRNGTIRRS  480
SRCMYIHPHK EYNQLRRVIW PLAPFGASPP AGALTPRPLL SLPRSTITGC RAPKDRNPRR  540
AVTFVPLYDD GRLRIPNCLL LRVRAPGPGV FRPRSPLATR QVERISISAV TGRRGRRRSG  600
PWASRAAGPG SRVPAARVSR GAQLSLSVRR WDTNDSAVAS SSGIMCGHAE LQLAGTVLSP  660
SRRERRTARR VVRARMFSRC SPDNACTHQA AAPPARTSCC RALRGLASSP FPLHFCARGR  720
CLPCLHTLLF PPHAFLSIAG SSSREACARA QDTSMGFHRA FALSTTTTIT ASTNARHGHP  780
HLPDFTPLLT SDKTITV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A4e-369519411110LOB family transfactor Ramosa2.1
5ly0_B4e-369519411110LOB family transfactor Ramosa2.1
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc00103.1.g00700.1.am.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1219191e-102AK121919.1 Oryza sativa Japonica Group cDNA clone:J033106D14, full insert sequence.
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30340.14e-51LOB domain-containing protein 13