PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00083.1.g00290.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 616aa    MW: 66153.2 Da    PI: 6.2412
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00083.1.g00290.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1115.4e-3560114458
                        zf-Dof   4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrkn 58 
                                   +  +cprC s++tkfCyynny++sqPr+fC+aCrryWt GG+lrnvP+Gg++rk 
  Zpz_sc00083.1.g00290.1.am.mk  60 QGEQCPRCASHDTKFCYYNNYNTSQPRHFCRACRRYWTLGGSLRNVPIGGSTRKX 114
                                   5679*************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074789.0E-2361113IPR003851Zinc finger, Dof-type
PfamPF027011.0E-3061114IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.16762116IPR003851Zinc finger, Dof-type
PROSITE patternPS01361064100IPR003851Zinc finger, Dof-type
Gene3DG3DSA:2.60.120.3307.3E-109266600IPR027443Isopenicillin N synthase-like
SuperFamilySSF511974.74E-102268597No hitNo description
PfamPF142264.7E-28296412IPR026992Non-haem dioxygenase N-terminal domain
PRINTSPR006823.1E-8317334IPR002283Isopenicillin N synthase
PROSITE profilePS5147113.495458559IPR005123Oxoglutarate/iron-dependent dioxygenase
PfamPF031712.3E-28462559IPR005123Oxoglutarate/iron-dependent dioxygenase
PRINTSPR006823.1E-8482503IPR002283Isopenicillin N synthase
PRINTSPR006823.1E-8547565IPR002283Isopenicillin N synthase
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0055114Biological Processoxidation-reduction process
GO:0003677Molecular FunctionDNA binding
GO:0005506Molecular Functioniron ion binding
GO:0016491Molecular Functionoxidoreductase activity
Sequence ? help Back to Top
Protein Sequence    Length: 616 aa     Download sequence    Send to blast
MAGQQAPVSL AQLQANDKIC DHLGTPAAAT MSASVSCGAA TTTTTAAEMA NNGNGGGGSQ  60
GEQCPRCASH DTKFCYYNNY NTSQPRHFCR ACRRYWTLGG SLRNVPIGGS TRKXXXXXXP  120
PQGLLGSLFA LGAAAAPLLE GRGGAGFDLG LGLTVPGGAA FGGAGEMQGL GVRGGLGGTS  180
ALLWPAGLLD SDSVDVWKAP GVGAAMWPEF SAAAAPPQTS GLLHGGVQLI GCRANSRAED  240
VAALVGRPHN NKRIGVLTYT LRQQSITMGG FTMEQAFVQA PEHRPKAADV VEATGIPVID  300
LTPLADAARV DAMAAEVGAA CRDWGFFAVV GHGVPAEAVA HAAEAQRAFF ALPAERKAAV  360
RRVEASPLGY YEAEHTKNVR DWKEVFDFAP YELPPAVVPD GELVLRNRWP DEDLPGFREA  420
MEQYGKAMEE LAFKVLELIA RSLNLPPDLL HGFFKVGQTT FIRLNHYPPC PNPDLALGVG  480
RHTDSGALTI LNQDDVGGLD VLRRSDGEWV RVKPVPDSFI INVGDITQVW SNDRYMSPEH  540
RASVNSEKER FSIGYFFNPA NSTMVEPLDE LVNEENPARY KAYNVGDFYN IRKHSNFKKL  600
DVENVQISHF RKILDS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5o7y_A2e-4728560146357Thebaine 6-O-demethylase
5o9w_A2e-4728560146357Thebaine 6-O-demethylase
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc00083.1.g00290.1.am.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001149543.10.0uncharacterized LOC100283169
TrEMBLA0A3L6EJT20.0A0A3L6EJT2_MAIZE; Putative 2-oxoglutarate-dependent dioxygenase
TrEMBLB4FV700.0B4FV70_MAIZE; Gibberellin 20-oxidase4
TrEMBLB6TF990.0B6TF99_MAIZE; Gibberellin 20 oxidase 2
STRINGGRMZM2G060940_P010.0(Zea mays)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.13e-25DOF zinc finger protein 1