PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00083.1.g00170.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family LBD
Protein Properties Length: 295aa    MW: 31508.2 Da    PI: 7.2299
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00083.1.g00170.1.sm.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260133.67.7e-4261051100
                        DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvil 81 
                                   +CaaCk+lrrkC+++Cv+apyfp ++p+kfanvh++FGasnv+kll++lp+ +reda++sl+yeA+ar+rdPvyG+v+ i+
  Zpz_sc00083.1.g00170.1.sm.mk   6 PCAACKLLRRKCTQGCVFAPYFPPDNPAKFANVHRVFGASNVSKLLHDLPHAQREDAVNSLAYEADARLRDPVYGCVSYIS 86 
                                   7******************************************************************************** PP

                        DUF260  82 klqqqleqlkaelallkee 100
                                    lq +++q++ ela++++e
  Zpz_sc00083.1.g00170.1.sm.mk  87 VLQLRIRQARDELAAARKE 105
                                   **************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.3045106IPR004883Lateral organ boundaries, LOB
PfamPF031951.9E-416103IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009954Biological Processproximal/distal pattern formation
GO:0009965Biological Processleaf morphogenesis
GO:0048441Biological Processpetal development
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MSSSSPCAAC KLLRRKCTQG CVFAPYFPPD NPAKFANVHR VFGASNVSKL LHDLPHAQRE  60
DAVNSLAYEA DARLRDPVYG CVSYISVLQL RIRQARDELA AARKELAAYI GPAAYAPFAP  120
VPPQYHHHHH AAAAQNAAGM PLAAAGIGLV VESQNAHGHA QQQQIMAQQH QHLHHHQQLA  180
EVHAQQLAAA VEVARDQDLM TRQAAAYPHA VPGSNASPTL AVVPPDASRY EGGFLFQHQQ  240
QPPSHSQAQT GVALTYQMER SPPPSSSGQS PPAEVSHQQH AEGSDEGGGG VVPPA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A9e-4731098114LOB family transfactor Ramosa2.1
5ly0_B9e-4731098114LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc00083.1.g00170.1.sm.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3681341e-103AK368134.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2068L23.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012704292.11e-115LOB domain-containing protein 6
TrEMBLA0A1E5VYJ41e-117A0A1E5VYJ4_9POAL; LOB domain-containing protein 36
STRINGSi036905m1e-114(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP61433456
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.14e-54ASYMMETRIC LEAVES 2-like 1