PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00080.1.g00200.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family G2-like
Protein Properties Length: 214aa    MW: 23356.8 Da    PI: 4.6251
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00080.1.g00200.1.sm.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like25.53e-0818472655
                       G2-like 26 kAtPktilelmkvkgLtlehvkSHLQkYRl 55
                                   AtPk+i  lm+v+++ ++++  HLQk+R 
  Zpz_sc00080.1.g00200.1.sm.mk 18 SATPKKIELLMNVNSIDRKQISAHLQKHRK 47
                                  79**************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
TIGRFAMsTIGR015571.3E-71148IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.607.6E-71749IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009736Biological Processcytokinin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 214 aa     Download sequence    Send to blast
MVIAKTTEDV IVVIDEASAT PKKIELLMNV NSIDRKQISA HLQKHRKRMD KELKDSMLLK  60
KAGKNSSSSR RLRKSCEEAV SENNDIQPED RTVTENIIRE TKGRKVYEAM RKALQHGTVF  120
DEQLSDDPSA EEAEQGEAYV MEDSIAQDDA AGPTGGQSAA ESGVTDASSD HNIAEVEPMD  180
NGTNEMQGST GSKAAAQSII NHPNSKVDES PENC
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc00080.1.g00200.1.sm.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP59202345