PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00064.1.g00330.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 901aa    MW: 94789 Da    PI: 9.7288
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00064.1.g00330.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof109.81.3e-343090262
                        zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                                  ++ al+cprC++t+tkfCyynny++ qPry+CkaC+ryWt+GG+ rn+PvGg++rk++k+s
  Zpz_sc00064.1.g00330.1.am.mk 30 PDVALACPRCNATETKFCYYNNYNMLQPRYLCKACKRYWTHGGSQRNIPVGGASRKQNKRS 90
                                  567899**************************************************99876 PP

2zf-Dof109.31.9e-34467527262
                        zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                                   ++ al+cprC++tntkfCyynny++ qPry+CkaC+ryWt+GG+ rn+PvGg++rk+ k+s
  Zpz_sc00064.1.g00330.1.am.mk 467 PDVALPCPRCHATNTKFCYYNNYNMLQPRYLCKACKRYWTHGGSQRNIPVGGASRKQSKRS 527
                                   567899**************************************************98876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074788.0E-222489IPR003851Zinc finger, Dof-type
PfamPF027012.0E-293388IPR003851Zinc finger, Dof-type
PROSITE profilePS5088426.8413488IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103672IPR003851Zinc finger, Dof-type
ProDomPD0074781.0E-19460518IPR003851Zinc finger, Dof-type
PfamPF027011.4E-29470525IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427471525IPR003851Zinc finger, Dof-type
PROSITE patternPS013610473509IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 901 aa     Download sequence    Send to blast
MQEARNMRQA RAARQQAAAN VGERRARPQP DVALACPRCN ATETKFCYYN NYNMLQPRYL  60
CKACKRYWTH GGSQRNIPVG GASRKQNKRS SASSSLPAAA ASSSSVINKE LQQQLLPAAP  120
MIEAAADFSN VFPSFMPTGF EHHSNQLPFS PAPAPLPLPT LLPPVPMLAS DAGTPSFLDM  180
LRGGFLDYQT NGFYAPATAS SGMEAPPPLP FGPAVQPGVA GILQGGGAAP TGGRVDATAA  240
GQGAAWPKPQ AHPQRAGSDG SGEATEDAHD GGGCSGAGRT LTRTHIDLFP AIIRMLFHVY  300
GAAAVTLGIQ MAVGMLPPGC TVDAWSARST RTSAVLPCRA SCLHGNSVSI SISSCMDRVL  360
ADVICTPIMP GDMWGPFYPL PPHRPLSPLL DFLVVLSPRR VQYKMEGNLF CGSEEKMTNS  420
KKSNTSAGAS SAHSNNIQQE ARNMRQARAA RQQVAANAGE RRPRPQPDVA LPCPRCHATN  480
TKFCYYNNYN MLQPRYLCKA CKRYWTHGGS QRNIPVGGAS RKQSKRSSAS LSLPAAASSS  540
SVINKELQQQ LLPAAPMIEP AADFNVFPSF MSTGFEHHGN QLPFSPAPAP LPLPTLLPPA  600
PVLAPDAGTP SFLDMLRGGF LDYQTNGFYA PATPSTGMEA PPPLPFGGAA QPGVAGGRQG  660
GGAAPTGGHV DATAAGQGAA WPKPQGRTPS QPFLSPSRRI VAVRASVFSA PPPSPLSAPD  720
PPPPRTATAQ TSPSAVSLPS ARHSLCSLSP TCVLYRTSAA RCRAHPSPPP NPSPGLCTTP  780
PLASLVVPYA RGHGVHSALL VPVVSSLPRQ SVNRIGCGID GSGFERQLGT VVAACSGRGV  840
ARLSLLACTP VHTRALPALH PHSCARLSSY QLVALVEAGV QPDHLSHIWV HHNLIINPRQ  900
E
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1655661GGRQGGG
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc00064.1.g00330.1.am.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004980592.15e-45dof zinc finger protein PBF
TrEMBLA0A368S7T61e-43A0A368S7T6_SETIT; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2247437
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24060.11e-29Dof family protein