PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00060.1.g00790.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 433aa    MW: 46078.7 Da    PI: 8.0744
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00060.1.g00790.1.sm.mkhcgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof126.48.8e-4099159262
                          zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                                     ++k+l+cprC+s++tkfCyynny+++qPr+fCk+C+ryWt+GGa+rnvPvG+grrk+k++s
  Zpz_sc00060.1.g00790.1.sm.mkhc  99 PDKILPCPRCNSMDTKFCYYNNYNINQPRHFCKNCQRYWTAGGAMRNVPVGAGRRKSKSAS 159
                                     7899*****************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074785.0E-2795148IPR003851Zinc finger, Dof-type
PfamPF027012.8E-32101157IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.929103157IPR003851Zinc finger, Dof-type
PROSITE patternPS013610105141IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 433 aa     Download sequence    Send to blast
MAECRAGGGG GGDGLIKLFG KTIPVPEAAT AVGDADRDLQ RSGSNTTEPK GHETTLPDST  60
GSPSQQGVTD TEESSAENNS LADQQQGDPT KQKEKLKKPD KILPCPRCNS MDTKFCYYNN  120
YNINQPRHFC KNCQRYWTAG GAMRNVPVGA GRRKSKSASA ASHFLQRVRA ALPVDPLCIS  180
AKINGTVLSF GSDTSSLDLT EQKKHLKEKL VPVTRIKNVD DQSIGSCAGE GSPKGGEPKL  240
INQKEQVVTA DKSASVVQHP CMNGVTMWPF SCAPPPACYT SGIPILFYPA AAAYWGCMVP  300
GAWNSPWLSH FQSEYATSPS SASPASIKSN CFTSGKRPRD GDEEGNAPGN GKVWVPKTIR  360
IDDADEVARS SILSLIGING DKVGKDGKGC KLSSIFEPKD EAETATHAII NGLPFLQGNP  420
AALSRSLTFQ EGS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00394DAPTransfer from AT3G47500Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc00060.1.g00790.1.sm.mkhc
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004985552.10.0cyclic dof factor 1
TrEMBLC7EAG30.0C7EAG3_ELECO; Dof-type zinc finger protein
STRINGPavir.Ia04317.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20993793
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.23e-50cycling DOF factor 2