PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00060.1.g00640.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bHLH
Protein Properties Length: 125aa    MW: 14078 Da    PI: 9.7151
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00060.1.g00640.1.sm.mkhcgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH22.22.6e-0753921554
                                    HHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
                             HLH 15 riNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54
                                    +i +  ++L++llP+a  +++ ++  a +L++++ YI+sL
  Zpz_sc00060.1.g00640.1.sm.mkhc 53 QISDLVSKLQDLLPEARLQSNARVPSARVLQETCSYIRSL 92
                                    789999*********889********************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.280.107.7E-837111IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PROSITE profilePS5088810.6263892IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474592.62E-851112IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000101.6E-45392IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 125 aa     Download sequence    Send to blast
MVVLSPSRAH RVRYDARVDE YKNDATLATT LIKMSSRRSR SRQSGSSRIT EEQISDLVSK  60
LQDLLPEARL QSNARVPSAR VLQETCSYIR SLHREVDGLS ERLSELLATS DMSSAQEAVI  120
RSLLM
Functional Description ? help Back to Top
Source Description
UniProtAtypical and probable non DNA-binding bHLH transcription factor that acts as a positive regulator of grain size. Binds the transcription repressor APG and forms a heterodimer of antagonistic bHLH transcription factors that regulates grain length and weight by controlling cell elongation in lemma and palea. May be involved in the control of lamina inclination through brassinosteroid signaling pathway (By similarity). {ECO:0000250}.
UniProtAtypical and probable non DNA-binding bHLH transcription factor that acts as a positive regulator of grain size. Binds the transcription repressor APG and forms a heterodimer of antagonistic bHLH transcription factors that regulates grain length and weight by controlling cell elongation in lemma and palea. May be involved in the control of lamina inclination through brassinosteroid signaling pathway. {ECO:0000269|PubMed:22363621}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc00060.1.g00640.1.sm.mkhc
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004985540.23e-43transcription factor ILI6
SwissprotB8APB55e-41ILI6_ORYSI; Transcription factor ILI6
SwissprotQ0DUR25e-41ILI6_ORYSJ; Transcription factor ILI6
TrEMBLA0A2T7CH026e-42A0A2T7CH02_9POAL; Uncharacterized protein
TrEMBLA0A368SV837e-42A0A368SV83_SETIT; Uncharacterized protein
STRINGSb01g045710.11e-42(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26753378
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26945.18e-29bHLH family protein