PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00046.1.g00660.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family G2-like
Protein Properties Length: 375aa    MW: 40328.2 Da    PI: 6.8809
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00046.1.g00660.1.sm.mkhcgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like39.41.3e-12266295130
                         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPk 30 
                                     k+r+rWt++LHerFv++v++LGG+++  P+
  Zpz_sc00046.1.g00660.1.sm.mkhc 266 KTRIRWTQDLHERFVDCVNKLGGADRVDPS 295
                                     68************************9886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.9E-9265301IPR009057Homeodomain-like
TIGRFAMsTIGR015571.9E-7266295IPR006447Myb domain, plants
PfamPF143793.7E-7299323IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 375 aa     Download sequence    Send to blast
MQSERENCQE VSVLPAAYSQ VFRDPVITAM NTKKIKLHDH HSYGSQMCDP HLFQATAAGF  60
NFHQGLVSSG HSVPQQNGGG GGNWPQEEYS SQTPRSALAT QGVCVGSDPA SFFAAENLIG  120
MARFDCALPP MAGLRTAPFG RALEADQLHR SVDPPLLRDD SVRTHYVPPQ QRDAATAHPA  180
LELLLQQQGL FGHASIARLL GGEPQNHPFS PHVAASTLLP AMAGPSVTSP MDRENALSRS  240
CSTGAPTTRT GNMVTATTLG QGAPSKTRIR WTQDLHERFV DCVNKLGGAD RVDPSGTHIQ  300
RNLQLKIEEQ GKKLQKMFEE QLKASKSVLE PPRENRQDAG AASAVLGEDD DVQLLSVASS  360
GFNDAGFPSK IKLPS
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc00046.1.g00660.1.sm.mkhc
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004960202.11e-114uncharacterized protein LOC101784276
RefseqXP_004960204.11e-114uncharacterized protein LOC101784276
TrEMBLK3Z6D01e-113K3Z6D0_SETIT; Uncharacterized protein
STRINGSi022099m1e-114(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP69333751
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06800.21e-11G2-like family protein