PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00042.1.g00350.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family LBD
Protein Properties Length: 399aa    MW: 43686.6 Da    PI: 10.3262
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00042.1.g00350.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260130.85.7e-411082071100
                        DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvil 81 
                                   +CaaCk+lrrkC+++Cv+apyfp ++p kfa vh++FGasnv kll++lp+ +reda++sl+yeA+ar+rdPvyG+v+ i+
  Zpz_sc00042.1.g00350.1.am.mk 108 PCAACKLLRRKCTQGCVFAPYFPPDNPVKFASVHRVFGASNVFKLLNKLPHAQREDAVNSLAYEADARLRDPVYGCVSYIS 188
                                   7******************************************************************************** PP

                        DUF260  82 klqqqleqlkaelallkee 100
                                    lq +++q++ ela++++e
  Zpz_sc00042.1.g00350.1.am.mk 189 VLQLRIKQARDELAAARKE 207
                                   **************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.143107208IPR004883Lateral organ boundaries, LOB
PfamPF031951.3E-40108205IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 399 aa     Download sequence    Send to blast
LNAPDRLPRS IKERTPRRLH PDHTLSSLLP ARLLPTHCLP SARRSAESIR IFLPFFPGFV  60
ASWLQLRRPS VIRQDRHSAA AVRSHLDPQI RRRRRRWMSS SSSSSSSPCA ACKLLRRKCT  120
QGCVFAPYFP PDNPVKFASV HRVFGASNVF KLLNKLPHAQ REDAVNSLAY EADARLRDPV  180
YGCVSYISVL QLRIKQARDE LAAARKELAA YIGPAAYAPF APAPTQYHHH AHATASAQYA  240
AGVPLAAAGI GLCVAPQNAQ GHGQQQQMMA QQHQHLLHHQ QLAEAQQLAA AVEVAREQDF  300
MMRQAPQAAA YAHTVPCSNA GPTVAVVPPD ESRTSRYERG FLFQQQQQPP LQAQTAVALT  360
NQMAWSPPPS SSSQPPAVVS HQQQAEGSYE GGGGVVPPA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A5e-451012114114LOB family transfactor Ramosa2.1
5ly0_B5e-451012114114LOB family transfactor Ramosa2.1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
19095RRRRRR
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc00042.1.g00350.1.am.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012704292.11e-106LOB domain-containing protein 6
TrEMBLA0A1E5VYJ41e-111A0A1E5VYJ4_9POAL; LOB domain-containing protein 36
STRINGSi036905m1e-105(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP61433456
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.17e-48ASYMMETRIC LEAVES 2-like 1