PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00042.1.g00220.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 272aa    MW: 28030.5 Da    PI: 8.6887
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00042.1.g00220.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof99.81.7e-3178131659
                        zf-Dof   6 lkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknk 59 
                                    + prC s++t+fCyy ny++s Pr+fC+aCrryWt GG+lrnvP+Gg++rk  
  Zpz_sc00042.1.g00220.1.am.mk  78 EQSPRCASHDTRFCYYKNYNTSHPRHFCRACRRYWTLGGSLRNVPIGGSTRKCP 131
                                   578************************************************965 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088425.03378132IPR003851Zinc finger, Dof-type
PfamPF027011.3E-2678130IPR003851Zinc finger, Dof-type
ProDomPD0074781.0E-2079125IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MMEAPLHQRS SSLSLGPQLQ ANYKSDHHLA IATSVAAKMA VSGCGSAATT AAETAYLQQL  60
HQTTAVTEAN GNNGARGEQS PRCASHDTRF CYYKNYNTSH PRHFCRACRR YWTLGGSLRN  120
VPIGGSTRKC PRLAHPTSAP PASRRHVVFG GGSAAAPPTG LLGSLFALGG AAPVREGRSG  180
SGFELGRGLP MPSGAGGAFG GDGEICAQMQ GLGVRDGLGG ASELLWPAGL LDNGIADEWK  240
VPSVSEATWP EFSAAVAPPQ AGGLLHGGAQ LM
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc00042.1.g00220.1.am.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC5824062e-68KC582406.1 Sorghum bicolor dof9 protein (dof9) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008644658.16e-61dof zinc finger protein DOF3.4
TrEMBLA0A1D6GLQ11e-59A0A1D6GLQ1_MAIZE; Dof zinc finger protein DOF1.6
STRINGGRMZM2G061292_P012e-60(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.14e-25DOF zinc finger protein 1