PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00039.1.g00250.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family BES1
Protein Properties Length: 167aa    MW: 18532.8 Da    PI: 10.4893
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00039.1.g00250.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822128.76.7e-40401492113
                        DUF822   2 gsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaa 82 
                                   +s r+pt +ErEnn++RERrRR++aa+iyaGLRa+++y lpk+aD+n+Vl+ALc+eAG+ v++DG + r   +++e     
  Zpz_sc00039.1.g00250.1.am.mk  40 TSLRHPTPRERENNRLRERRRRQVAARIYAGLRAHAGYVLPKHADQNDVLRALCAEAGYHVDEDGVVTR--LQRPEGGRGP 118
                                   789****************************************************************99..5555567777 PP

                        DUF822  83 gssasaspesslqsslkssalaspvesysas 113
                                    +s+++++ s  + ++++ +l+    +++++
  Zpz_sc00039.1.g00250.1.am.mk 119 SCSSDQQKPSTASGTTEAVTLQQLELEQKQQ 149
                                   7777666666656444444444333333333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056874.1E-3142128IPR008540BES1/BZR1 plant transcription factor, N-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 167 aa     Download sequence    Send to blast
MEVAGAGREE GEAAGRRGCI RSKQGPWTVR RRGRGGGVTT SLRHPTPRER ENNRLRERRR  60
RQVAARIYAG LRAHAGYVLP KHADQNDVLR ALCAEAGYHV DEDGVVTRLQ RPEGGRGPSC  120
SSDQQKPSTA SGTTEAVTLQ QLELEQKQQR EEKAKLSLDL TLSFAYM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5zd4_A4e-1263108392437Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1
5zd4_B4e-1263108392437Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1
5zd4_C4e-1263108392437Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1
5zd4_D4e-1263108392437Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc00039.1.g00250.1.am.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9477562e-95EU947756.1 Zea mays clone 356679 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004971713.11e-64protein BZR1 homolog 3-like
TrEMBLA0A368R3Z73e-63A0A368R3Z7_SETIT; Uncharacterized protein
STRINGPavir.Eb00361.1.p1e-60(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP132013032
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19350.32e-15BES1 family protein