PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00033.1.g00210.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family G2-like
Protein Properties Length: 532aa    MW: 55477 Da    PI: 7.6942
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00033.1.g00210.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like90.51.4e-28249298251
                       G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 
                                   pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ
  Zpz_sc00033.1.g00210.1.am.mk 249 PRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQ 298
                                   9************************************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.94E-13246299IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.4E-25247298IPR009057Homeodomain-like
TIGRFAMsTIGR015577.1E-21249299IPR006447Myb domain, plants
PfamPF002491.9E-5250298IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 532 aa     Download sequence    Send to blast
MEASSAASPD LSLHISLPST GPSGGRAVAG GAGGGAGGDP WRRLNGSTAS TELSLSPPAE  60
PDADALPWRH RPSAVASSSA ATTSSALMHV PMLQPLNDGG GAAGGGVDVS AAPPIQGIPI  120
YNGPGGFPFL PPAPGADGHQ KVGFYGSYHH PATWPSSLGS TMPSPLAPGA SSFDPASAFL  180
SPAAHHHHRM LSASGRFNGM LTDTLRGYGA GGMGGIGGHH HHHLHGAQPF GLGSRFMPKF  240
PAKRSMRAPR MRWTSTLHAR FVHAVELLGG HERATPKSVL ELMDVKDLTL AHVKSHLQLL  300
PFLLLFGSDK NANAVTPELV NDGETDGWGL AAKKLPLFVC VRAHGPKLQN HGQRERRERE  360
GKGIAATGGR DGPRRGHDIM VFPSVHFLVF LALIHLLVIR LLVSSPPRGP ADGGSGDDEF  420
SGASQAASGG DNMCVRPFGE HRSTSEGAAS SVGGCGGDMD QSSAGNTNIR WGNSSRDPWV  480
SLNSCNMDGH RLLFQNAEPC RSSSSQVSNH ELSSPSLEFT LGRPDWQGAD HD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A2e-14250298351Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-14250298351Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-14250298351Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-14250298351Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that regulates abaxial identity during leaf development. {ECO:0000269|PubMed:18594992}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc00033.1.g00210.1.am.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9253981e-108EU925398.1 Zea mays milkweed pod1 (mwp1) mRNA, complete cds.
GenBankEU9546671e-108EU954667.1 Zea mays clone 1476543 myb-like DNA-binding domain, SHAQKYF class family protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001353566.11e-117uncharacterized protein LOC100280930 isoform 1
SwissprotQ0J2351e-83ROLL9_ORYSJ; Probable transcription factor RL9
TrEMBLA0A1D6I3X21e-116A0A1D6I3X2_MAIZE; Milkweed pod1
STRINGGRMZM2G082264_P011e-116(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25583787
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.11e-34G2-like family protein