PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00031.1.g00940.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 378aa    MW: 39395.7 Da    PI: 9.399
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00031.1.g00940.1.sm.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.24.2e-3990150262
                        zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                                   +e alkcprCds ntkfCyynnyslsqPr+fCk+CrryWt+GG+lrnvPvGgg+r+nk+ss
  Zpz_sc00031.1.g00940.1.sm.mk  90 PEPALKCPRCDSINTKFCYYNNYSLSQPRHFCKTCRRYWTRGGSLRNVPVGGGCRRNKRSS 150
                                   67899*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-3574148IPR003851Zinc finger, Dof-type
PfamPF027015.6E-3393148IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.58194148IPR003851Zinc finger, Dof-type
PROSITE patternPS01361096132IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 378 aa     Download sequence    Send to blast
MVFPSVPAYL DPPNWNNQAY VSVQQQGQQP RASGGGDAPL LPVDPAAATA TPPEATGLPS  60
SSTAASASVA TQARPNSMAE RARLARMPQP EPALKCPRCD SINTKFCYYN NYSLSQPRHF  120
CKTCRRYWTR GGSLRNVPVG GGCRRNKRSS KSSSSGASSS SSKPSSSARQ LPSGPSSTPS  180
TPGGITGGII PPGLGSLSHQ YLPFLGSMHQ PGGNLGLTFS AGLPPHGMQH VDAVDQFPVA  240
SGGASLDQWR VHQQQPQQQF PFLAGGVLDL QPRPQMYQLG LEANRGSGGS AASAFTLGQA  300
SGTTAREGPM KLDLDDSKGQ EMSLQRQYMA ALRHGEDIWD GNTGGSAGDG RGNDGAGWPM  360
NVPGFRSSST GGDGSGLL
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc00031.1.g00940.1.sm.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025791451.11e-148dof zinc finger protein DOF5.1-like isoform X2
TrEMBLA0A2S3IRW01e-147A0A2S3IRW0_9POAL; Uncharacterized protein
STRINGPavir.J14669.1.p1e-145(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP123012432
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02460.13e-41Dof family protein