PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00031.1.g00150.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 467aa    MW: 47826.1 Da    PI: 9.2351
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00031.1.g00150.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.47.7e-39155215262
                        zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                                   +e+ l+cprCds ntkfCyynnyslsqPr+fCk CrryWtkGGalrnvP+Ggg+rknk+s+
  Zpz_sc00031.1.g00150.1.am.mk 155 PEQGLRCPRCDSPNTKFCYYNNYSLSQPRHFCKMCRRYWTKGGALRNVPIGGGCRKNKRSR 215
                                   67899*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027011.5E-32157213IPR003851Zinc finger, Dof-type
ProDomPD0074785.0E-28159212IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.301159213IPR003851Zinc finger, Dof-type
PROSITE patternPS013610161197IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010052Biological Processguard cell differentiation
GO:0010118Biological Processstomatal movement
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1902066Biological Processregulation of cell wall pectin metabolic process
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 467 aa     Download sequence    Send to blast
MGRRLVASMK AISSSPGTMP RRGGTLPVGR VNRRGADRAA LVALLAQHSV IACSLLDCSS  60
TLIKARPANI WRAGSLELII SRRPAGAVQS EAEVTSALDG DRRRQSADPA AAGCGSWCCM  120
ASSTAVAGGE DVVGPRTGGG NGGGGTTPQQ QPPPPEQGLR CPRCDSPNTK FCYYNNYSLS  180
QPRHFCKMCR RYWTKGGALR NVPIGGGCRK NKRSRSSVMS ASAAVAAASS HLSLNLPVDG  240
IGVTAASADQ QVAARLGFLG VGAPVVSSPI GGTPAADYQG AAVGMMALPR INAPAVGHYL  300
PFGERPSGPG VDITGVGGHA MSGGPTGAVP VSSNIASSIE SLSFINQDLH WKLQQQRLAT  360
MILSRPPSSG AAVHVEGAAT EHVSGPFMQM AGVSAMDAVP VETSWFMDSS YVLPLHNTAA  420
AIGNSTSNGN VNSGRSSADD GNATSNSNCG SAMIPAWGDM STFAMLP
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc00031.1.g00150.1.am.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9475241e-71EU947524.1 Zea mays clone 346044 mRNA sequence.
GenBankKJ7269771e-71KJ726977.1 Zea mays clone pUT3678 C2C2-DOF transcription factor (DOF32) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025796800.11e-104dof zinc finger protein DOF5.7-like
TrEMBLA0A3L6SBJ51e-106A0A3L6SBJ5_PANMI; Dof zinc finger protein DOF5.7-like
STRINGSi036311m1e-101(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65590.18e-35Dof family protein