PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00022.1.g00320.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 635aa    MW: 67085.5 Da    PI: 9.0773
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00022.1.g00320.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof119.61.2e-37406463562
                        zf-Dof   5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                                   +l+cprCdstntkfCy+nnyslsqPr+fCkaCrryWt+GGalrnvPvGgg+r+n k+s
  Zpz_sc00022.1.g00320.1.am.mk 406 TLRCPRCDSTNTKFCYFNNYSLSQPRHFCKACRRYWTRGGALRNVPVGGGCRRNTKRS 463
                                   679***************************************************9886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-26398455IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.385407461IPR003851Zinc finger, Dof-type
PfamPF027013.0E-31407461IPR003851Zinc finger, Dof-type
PROSITE patternPS013610409445IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 635 aa     Download sequence    Send to blast
MDAYLTLLSL ASKHATVALS RDGGLPFLAE FAPAAARCAS AKADLPALRR PGTPRQASRP  60
APCRCPVAIF DRNLAGTWGA FAFDLAGAAL CFGSLICGNS VGLPRRTVAE EEEASARKRD  120
ALLLTLKPLM LSCRFGDSSA GTHSLLPVRP RQAVVAPSRR PLSFDPSAVT YVDERASSRR  180
REMAPRVGGT MPHLAFALFR LCDVYKYGAA GERGPSPSLD SSSPRLHPSR SPVTSIRRCE  240
LEPSGAIALA LVGAVHRTPP PLATLSSAPF LPLTLFACLS CLSLAALFLD KSYRVRAKES  300
CGEFVSSFSF YLDLALLVSS SSSGTCSCLF TASVAMVFSS LPIFLDPPSW GQMQVQQQQQ  360
QPLHCLLGGG SDHQHLMPPP SGLAPAXXXX XXXXXXXRVP LPEPGTLRCP RCDSTNTKFC  420
YFNNYSLSQP RHFCKACRRY WTRGGALRNV PVGGGCRRNT KRSSKKSSRQ GGVAAAGGAA  480
AASSSSSTTS TSTTPTTTTT SSAAAAEVLA SMQAQLPQFG LPPAAAAAAL EASLEGYQYH  540
HYLPLQMQQQ FLQQGLQGYH FADGDSGGVF ADGFPRGVAS GLLAQLAAVK MEEHNNGGAV  600
AAHEQSYWPS SGGGGNGWPT EFLPGFSSSS SGNVV
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc00022.1.g00320.1.am.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55370.14e-32OBF-binding protein 3