PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00022.1.g00200.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRAS
Protein Properties Length: 751aa    MW: 82784.8 Da    PI: 6.466
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00022.1.g00200.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS348.61e-1063707411373
                          GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaal 81 
                                   l++lL++cA+av+++d + a++lL++++++asp+gd +qRla++f+e+L+arla+++s +y++l +++ts    +  l+a+
  Zpz_sc00022.1.g00200.1.am.mk 370 LRTLLIHCAQAVATDDRRSATELLKQIKQHASPQGDGTQRLAHCFAEGLQARLAGTGSMVYQSLMAKRTS---AVALLQAY 447
                                   6789************************************************************999998...899***** PP

                          GRAS  82 klfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeelee 160
                                   +l+  +  + k++++  N++I +a  g++++Hi+D++i +G+QWp++l++++  ++gpp++ iTg++ p++g   +e++ee
  Zpz_sc00022.1.g00200.1.am.mk 448 QLYMAAICFKKVAFIFSNNTIFNASLGKKKIHIVDYGIHYGFQWPCFLKQISGMEGGPPEVTITGIDLPQPGfrPTERIEE 528
                                   ***********************************************************************9********* PP

                          GRAS 161 tgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvv 241
                                   tg+rL+++A+e+gvpf++++++a+++e+++ e+L+++ +E+l+Vn+++q ++l+desv +es+rd vL+ +++++P+ +++
  Zpz_sc00022.1.g00200.1.am.mk 529 TGRRLSNYAREFGVPFKYHAIAASKMESVRKEDLNIDLDEVLIVNCMYQFKNLMDESVVIESPRDVVLNNIRKMRPHTFIH 609
                                   ********************************************************************************* PP

                          GRAS 242 veqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleea 322
                                   +  + + +++ F++rf eal yysalfd l+++ pr+s++r+ +E+ ++gr++ nv+aceg++r+er et+++W+ r ++a
  Zpz_sc00022.1.g00200.1.am.mk 610 AIVNGSFSAPFFVTRFREALFYYSALFDVLDTTTPRDSDQRMLIEQNIFGRSALNVIACEGTDRVERPETYKQWQVRNQRA 690
                                   ********************************************************************************* PP

                          GRAS 323 GFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                                   G+k++pl+ ++++ ++  ++ ++ + + ++ ++++l++gWk+r L+++S W
  Zpz_sc00022.1.g00200.1.am.mk 691 GLKQLPLNRETVEIVRGKVKDCYHKDFVIDIDHHWLLQGWKGRILFAISTW 741
                                   ***********************889************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098561.831344722IPR005202Transcription factor GRAS
PfamPF035143.5E-104370741IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 751 aa     Download sequence    Send to blast
MQWKAGEKSP GPKPPLVGNG NAVECWRKVD GVERVMAWRC FCPLELILFR FNLPRISAVS  60
KSPFPPPPSR NLPLPVSTPC PPAAYKSTPS PLSLSSSRAR PRPATHAAAM GSSYDLYQSP  120
GADDPSLYLY LSDLVPDSPS AYLDLPPTPH HEQQQPPPVP AAAADDGAAA GSPEDLVLPY  180
ISRMLMEDDI EDKFFYDYPD NPSLLQAQQP FLEILSNSDD TTTTTTTTSS SGGDHNGDPS  240
PTSSSSDGAS APAPSPAPPV APAVTLSVKE ELVDAAPGNG VGRGRKNPYD HDELEVEGGR  300
SSKQSAVQGE DDATRDMLDR VMMPSHEACV LQMQQLRIAM QEEAAKNEAG GKAGNGKANG  360
RRGGRDVVDL RTLLIHCAQA VATDDRRSAT ELLKQIKQHA SPQGDGTQRL AHCFAEGLQA  420
RLAGTGSMVY QSLMAKRTSA VALLQAYQLY MAAICFKKVA FIFSNNTIFN ASLGKKKIHI  480
VDYGIHYGFQ WPCFLKQISG MEGGPPEVTI TGIDLPQPGF RPTERIEETG RRLSNYAREF  540
GVPFKYHAIA ASKMESVRKE DLNIDLDEVL IVNCMYQFKN LMDESVVIES PRDVVLNNIR  600
KMRPHTFIHA IVNGSFSAPF FVTRFREALF YYSALFDVLD TTTPRDSDQR MLIEQNIFGR  660
SALNVIACEG TDRVERPETY KQWQVRNQRA GLKQLPLNRE TVEIVRGKVK DCYHKDFVID  720
IDHHWLLQGW KGRILFAIST WVANDAGCPY F
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-423747418374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006664663.20.0PREDICTED: scarecrow-like protein 9, partial
RefseqXP_015620149.10.0PREDICTED: scarecrow-like protein 34
SwissprotO809331e-165SCL9_ARATH; Scarecrow-like protein 9
TrEMBLA0A0D3HVY80.0A0A0D3HVY8_9ORYZ; Uncharacterized protein
STRINGOB12G23410.10.0(Oryza brachyantha)
STRINGORGLA12G0207400.10.0(Oryza glaberrima)
STRINGORGLA12G0145700.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-152GRAS family protein