PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00020.1.g01000.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family G2-like
Protein Properties Length: 293aa    MW: 31813.9 Da    PI: 8.9657
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00020.1.g01000.1.sm.mkhcgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like88.56.2e-28243293151
                         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 
                                     k+r++W+peLH+rFv a+++LGG+++AtPk+i+elmkv+gLt+++vkSHLQ
  Zpz_sc00020.1.g01000.1.sm.mkhc 243 KARRCWSPELHRRFVAALQRLGGAQVATPKQIRELMKVDGLTNDEVKSHLQ 293
                                     68************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.556240293IPR017930Myb domain
SuperFamilySSF466891.16E-12241293IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.0E-23241293IPR009057Homeodomain-like
TIGRFAMsTIGR015571.6E-22243293IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MGPAVRTDDV QALAARAVTD SLRAAAARSG VGEADRAARF EECVRDLEAE KAKMEVFRRE  60
LPISVHLVAD VIEWLKDELA QHRRPKASEL FAPVAVPEPA KRKVATEAED KRSWMSSAQL  120
WSCGSLDDST GNRNGAKKPA HKNENEFYRK STTCSRDCIV YFPPCVANPR CRHLPTQVPN  180
ASMPLNNGSQ AASARPTEAA TPLPDLSLSS PATDGSCPAG PSATSSAVTD AGAAQRQQQG  240
QRKARRCWSP ELHRRFVAAL QRLGGAQVAT PKQIRELMKV DGLTNDEVKS HLQ
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc00020.1.g01000.1.sm.mkhc
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020151221.11e-102myb family transcription factor EFM-like
TrEMBLA0A3B6MLQ61e-101A0A3B6MLQ6_WHEAT; Uncharacterized protein
STRINGTraes_5DS_13C2391DC.11e-98(Triticum aestivum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP55823353
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.16e-32G2-like family protein