PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00020.1.g00920.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 245aa    MW: 25106.6 Da    PI: 10.2947
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00020.1.g00920.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof110.39.1e-3548102660
                        zf-Dof   6 lkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                                    +cprC s +tkfCyynny+++qPr+fC+aCrryWt GG+lrnvPvGg++rk+ +
  Zpz_sc00020.1.g00920.1.am.mk  48 EQCPRCASWDTKFCYYNNYNTAQPRHFCRACRRYWTLGGSLRNVPVGGSTRKRPR 102
                                   68*************************************************9865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027011.9E-3048100IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.32648102IPR003851Zinc finger, Dof-type
ProDomPD0074787.0E-214994IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105086IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
MEALLHYAPV SMPVPAPRQQ GAVIGASAAL QQVSAVTAQK PPAGAGREQC PRCASWDTKF  60
CYYNNYNTAQ PRHFCRACRR YWTLGGSLRN VPVGGSTRKR PRPARRPTRA IAAALADASS  120
SAGTAAGAAT TPSSSLCGPF AASPVPSAAA VAAQNVGLLR SLLLGSVPLL EGRLGLGQPA  180
ASTGASDDLA QLGVSTGTPL WPVAGMEGDR ATETTWKSGG VFPPTTAMWQ ELAAATGAGM  240
PPRLL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
198102KRPRP
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc00020.1.g00920.1.am.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY6616595e-69AY661659.1 Sorghum bicolor clone BAC 75D9, complete sequence.
GenBankHQ5400845e-69HQ540084.1 Sorghum bicolor clone SbDof1 Dof-type zinc finger protein gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025805366.13e-47dof zinc finger protein MNB1A-like
TrEMBLA0A1E5VL722e-51A0A1E5VL72_9POAL; Uncharacterized protein
STRINGGRMZM2G131897_P015e-48(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28810.21e-24Dof family protein