PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00020.1.g00470.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bZIP
Protein Properties Length: 307aa    MW: 33473.9 Da    PI: 6.5186
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00020.1.g00470.1.sm.mkhcgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_142.81.2e-13113166457
                                     XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                          bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                                     +k+ rr+ +NRe+ArrsR+RK+  +  L+  v  L+aeN +L k l  ++++++
  Zpz_sc00020.1.g00470.1.sm.mkhc 113 VKKMRRMLSNRESARRSRRRKQIHLNDLKSQVSRLTAENASLLKCLVDMTQKYK 166
                                     799*************************************99976666555554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.7E-12110174IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.208112164IPR004827Basic-leucine zipper domain
PfamPF001703.0E-12112164IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.7E-11112166No hitNo description
SuperFamilySSF579592.49E-10114161No hitNo description
PROSITE patternPS000360117132IPR004827Basic-leucine zipper domain
PfamPF124983.2E-17182287IPR020983Basic leucine-zipper, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MAGFSGDEVA EVGCSYAAAL RRELDLYCAA VAKSMDAKSQ ESSLGYPNSQ ASVSSELISQ  60
ASFHGDRDGA SLFINSRIID NADSQGMSAN TGILKEQSGD ADDLEEITNP ANVKKMRRML  120
SNRESARRSR RRKQIHLNDL KSQVSRLTAE NASLLKCLVD MTQKYKDATF DNRNLIVDLE  180
MMRRKVYIAE EAVRVTGASM LLPPTASDMP VSSMPLTSCA SDAASLAVAV QENMHPFLQQ  240
PLIHGNQFKL DLPNATISLS SREMVTMAVS LRGVASMEYL QKRIHKDSVH SGTALPLSDP  300
EALNDGK
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1126133RRSRRRKQ
2128133SRRRKQ
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc00020.1.g00470.1.sm.mkhc
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025805357.11e-124light-inducible protein CPRF2-like
TrEMBLA0A2T7EIZ51e-124A0A2T7EIZ5_9POAL; Uncharacterized protein
STRINGPavir.Ca02738.1.p1e-116(Panicum virgatum)
STRINGPavir.Cb00258.1.p1e-117(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP75952943
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G28770.12e-26bZIP family protein