PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00015.1.g00460.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 1283aa    MW: 136009 Da    PI: 10.5677
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00015.1.g00460.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1071e-33120174559
                        zf-Dof   5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknk 59 
                                   +++ prC s++tkfCyynny+++qPr+fC+aCrryWt GG+lrnvPvGg++rk+ 
  Zpz_sc00015.1.g00460.1.am.mk 120 IQQRPRCASRDTKFCYYNNYNTAQPRHFCRACRRYWTLGGSLRNVPVGGSTRKRP 174
                                   5678************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027012.8E-28121173IPR003851Zinc finger, Dof-type
PROSITE profilePS5088426.301121175IPR003851Zinc finger, Dof-type
ProDomPD0074788.0E-21122168IPR003851Zinc finger, Dof-type
SMARTSM001294.3E-411351283IPR001752Kinesin motor domain
PROSITE profilePS5006722.14311451283IPR001752Kinesin motor domain
PfamPF002251.1E-1811771253IPR001752Kinesin motor domain
Gene3DG3DSA:3.40.850.106.3E-2111811253IPR001752Kinesin motor domain
SuperFamilySSF525401.01E-1911821254IPR027417P-loop containing nucleoside triphosphate hydrolase
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007018Biological Processmicrotubule-based movement
GO:0003677Molecular FunctionDNA binding
GO:0003777Molecular Functionmicrotubule motor activity
GO:0005524Molecular FunctionATP binding
GO:0008017Molecular Functionmicrotubule binding
Sequence ? help Back to Top
Protein Sequence    Length: 1283 aa     Download sequence    Send to blast
MLCGTFITCM DASRQQVEDM FVAPSPSLLI DEQHPLQQST SGLSGLSLKA TKELAAGRVH  60
GSVTAQQPCM PNESRRPAGP PPFVHVAVWK FCCRADEQSL SRERDKRLCD TAPASSSSAI  120
QQRPRCASRD TKFCYYNNYN TAQPRHFCRA CRRYWTLGGS LRNVPVGGST RKRPRPAPPT  180
RALAAAVATM SSSGTTTTTT TAAAPSCSGP SIFGGSPVPA PAQAPAPAQN GSLLSSLLVG  240
STGASDLFAY PAFSAGQLLC PATVLDGDRA ETTSKAGGAF PLPFPPANAL WQELAAAMPS  300
AAGAGAPQPQ PQLLLWAVLG LARPDSGPPC RVPCLGRILA ASGDRHGPTR HDGQAARGTT  360
VPGRHGMAQV PIGESSVDTS SGFDFRAPGF PNFKRHSAGN GRIEAARRRP PGRQVGTVIA  420
ILREAAVTDV DISPRRRLPP QVRTCFIKVW EKFDFFDGLP GRRPPLPSSP SSLRTSPLPS  480
TRFTAAVAAG RTSPPTQSPK PYSPPPVAVA GPPLLLMVRD AGAIRRAPAR PSGAGVGGDA  540
DAPPGATSRP PLRAIQPPAS GAPRWPVPTA SKGLGFRAGK APERVGAVST SLAPRKPGPK  600
PASRSGFTTA GTSSVGEPRS KVRDAISFWE ENSSKVQDQS SHSSAAQEKD EVLRQAEIET  660
AEDVSCTIMR KQWPVVEIME ENELPPYATT RLDDPVNYMR APSDELKRLR IHISADKTSM  720
TWMTDGRKIT TNKRAWEKSR TKDQLLYAPY IMGMKAAGAT PAVKSRLELT RAVDSHHKFH  780
QPAGYQPQVE AVQKRAAPVQ PMTRSDLFQI VEDGLRPIRD TLASMEGRIG RVEDGASAPA  840
RHINSSCSTS QIPAPNSSLA PSVQSTLTPP QAPAISHFSG KPSVVHADNP GASAQPVHPS  900
KVPKVRSQPP VRCHVDGRRC LRPVRPLPCC HCRRVVIRLR RWICIGAEEK ASRAGNLKFF  960
SSSVTDLARL NGRGAPFAAF PFSCSLPPPP RPRSGACLLP LFLLRHSMVR DLGAHRRTSS  1020
GRAPASGAGN DENVPAGDAP AAVAVATAAM GPDAASRPPL LAIQAPPXXX XWVQDLPPRA  1080
GGCATPYAAM TTPRAHRGKA AAAPAVSEGG GSTQSTPTKS VTKPVMSGSR PPISGGPRCA  1140
GFGSGFSAAG RGTPLSLGPV AVNSVEVPHF ELREDPSFWM ENNVQEMLFR VAGLPMVENC  1200
IAGYNSCVFA YGQTGSGKTY TMLGEISDLE IRPSPDRGMT PRIFEFLFAR IRAFSLHSLV  1260
SKTLIVESPL ETGRGHLVLK VSG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1171175KRPRP
2406413RRRPPGRQ
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc00015.1.g00460.1.am.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY6616592e-59AY661659.1 Sorghum bicolor clone BAC 75D9, complete sequence.
GenBankHQ5400842e-59HQ540084.1 Sorghum bicolor clone SbDof1 Dof-type zinc finger protein gene, complete cds.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1585922
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.19e-22DOF zinc finger protein 1