PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00011.1.g00130.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bHLH
Protein Properties Length: 303aa    MW: 32438.8 Da    PI: 4.5068
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00011.1.g00130.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH32.41.6e-10229267543
                                   HHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHH CS
                           HLH   5 hnerErrRRdriNsafeeLrellPkaskapskKlsKaei 43 
                                   h + Er+RR+++N++f++Lr+llP++sk ++k ++  + 
  Zpz_sc00011.1.g00130.1.am.mk 229 HMMSERKRREKLNDSFQTLRSLLPPCSKLHDKDVDRGSW 267
                                   7899*********************97555555555554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088811.325224278IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474591.09E-9225269IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.101.9E-9228269IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd000834.87E-8229256No hitNo description
PfamPF000105.2E-8229268IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SMARTSM003530.0048230274IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MDEEVWCDLD LQLPANDVAG LHRAAHDDPF WPALADCTAS FLSADDIDIT GSASDKVAVA  60
NDMVLDVDTS YFAAEQHQDL LMVQQDQTYS SSPSSKRSFS VDDSAGTTSS PFSFALDGAD  120
AALTAGANFD PFAGDDAAIM RAMMAILLSA SPSSSESSSP PQSQELNMQQ AAAVHPPRRG  180
GNNNNNGHVV AARSINSFAV GAEKTNSAGG GRQQQDDASR AAPSTQVYHM MSERKRREKL  240
NDSFQTLRSL LPPCSKLHDK DVDRGSWLEA QEDQILKKRG PLKVQLDAWK LPNGGSSLVV  300
LIA
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1232237ERKRRE
2233238RKRREK
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc00011.1.g00130.1.am.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025819658.17e-45putative transcription factor bHLH041
TrEMBLA0A0A9RPB92e-48A0A0A9RPB9_ARUDO; Uncharacterized protein
STRINGSb03g025860.12e-43(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP3449834
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56960.12e-10bHLH family protein