PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00008.1.g00760.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family M-type_MADS
Protein Properties Length: 438aa    MW: 48502.8 Da    PI: 9.823
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00008.1.g00760.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF60.91.5e-1972115245
                                   ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
                        SRF-TF   2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45 
                                   + en+  rq+t+skRr gilKKA+ELS+LCd+   +++fs+tgk
  Zpz_sc00008.1.g00760.1.am.mk  72 KLENNGGRQITYSKRRSGILKKAKELSILCDIHLILLLFSPTGK 115
                                   6799999***********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006621.1863115IPR002100Transcription factor, MADS-box
SMARTSM004321.4E-2163122IPR002100Transcription factor, MADS-box
PRINTSPR004045.1E-156585IPR002100Transcription factor, MADS-box
SuperFamilySSF554559.29E-2267150IPR002100Transcription factor, MADS-box
PfamPF003193.0E-1774116IPR002100Transcription factor, MADS-box
PRINTSPR004045.1E-1585100IPR002100Transcription factor, MADS-box
PRINTSPR004045.1E-15100121IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010152Biological Processpollen maturation
GO:0080092Biological Processregulation of pollen tube growth
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 438 aa     Download sequence    Send to blast
MIMVGARWLA GCAARQGEND EKKELTGGRR RRRQNSEFWM NQSGVQPLLM LDSILPPRSN  60
CELPGVKLKI KKLENNGGRQ ITYSKRRSGI LKKAKELSIL CDIHLILLLF SPTGKPTICI  120
GEKSTIEEVV AKYAQLTPQE RAKRKLDSLE TPDEDALFQL QNNMQLPLGL TGDPDTASWF  180
HNGGADVQQP LMLPDDHTLL HQSMSKQSTD TCSGSEQGQL SVQQPPPPDF CQVECLTSLH  240
LGTQFPYTSF DHTSLLNDRI FRLDGVELHD GGTSMDFGGG HFDLPRPGDE VSFQNWASTS  300
CGTAMFNHQR RQPQQQHHYQ QQPSAPSSLS RAILYLPSLS SPRTSFSLRV SSPGPDRPKN  360
VAGFAGSWPR HITYSRRKRS QRGSSKKRVT KQKGAAFVEQ DPGLGMNRMG GHSSKSGTHA  420
TPRVHKAAIE NPSAPHSP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1376387RKRSQRGSSKKR
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc00008.1.g00760.1.am.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025828481.11e-63agamous-like MADS-box protein AGL65
TrEMBLA0A0D9XUZ02e-96A0A0D9XUZ0_9ORYZ; Uncharacterized protein
STRINGLPERR11G18320.14e-97(Leersia perrieri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP46263659
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03060.22e-35AGAMOUS-like 30