PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00008.1.g00160.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRAS
Protein Properties Length: 859aa    MW: 95374.5 Da    PI: 5.0613
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00008.1.g00160.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS347.22.6e-1064788501373
                          GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaal 81 
                                   l++ L++cA+a+s+gdl+ a+++L+++++++s +g++++Rla++f+++L+arla+++s++yk+l +++ts   +++ l+a+
  Zpz_sc00008.1.g00160.1.am.mk 478 LRTMLIHCAQALSTGDLRGANETLKQIKQHSSLTGNATERLAHCFAQGLEARLAGTGSQVYKSLMSKRTS---VVDYLKAY 555
                                   5789************************************************************999999...******** PP

                          GRAS  82 klfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeelee 160
                                   klf  +s + k+ h+  N++I +av+g++++Hi+ +++++G+QWp Ll+ La+ ++gpp++R Tg++ p++g   + +le+
  Zpz_sc00008.1.g00160.1.am.mk 556 KLFMAASCFKKVKHVFSNRTIADAVAGKSKLHIVEYGVQHGFQWPGLLHFLANMEGGPPEVRFTGIDLPQPGfrPAYQLEK 636
                                   ***********************************************************************9999****** PP

                          GRAS 161 tgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvv 239
                                   tgerL++ A++++vpf+f++ +a ++e++++e+L+++p+E+l+Vn+   l +l+de+v ++s  +rd vLk +++++Pkv+
  Zpz_sc00008.1.g00160.1.am.mk 637 TGERLSNCARQFHVPFKFHA-IAAKWETVTPEDLNIDPDEVLVVNCECYLDKLMDETVVVDSpsPRDMVLKNIRNMRPKVF 716
                                   ********************.799*********************************98888779**************** PP

                          GRAS 240 vvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerle 320
                                   +++  +   +++ Fl+rf eal +ysa fd+l+a++pr+++ r  +Er +lgr++ nv+acega+r+er et+++W+ r +
  Zpz_sc00008.1.g00160.1.am.mk 717 IHCVVNGTFGAPFFLTRFREALFFYSAQFDMLDATIPRDNDVRLLIERDILGRSALNVIACEGADRVERPETYKQWQVRNN 797
                                   ********************************************************************************* PP

                          GRAS 321 eaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                                   +aG++++pl+ +++k ++  + +++ + + ++e++ +l++gWk+r L+++S W
  Zpz_sc00008.1.g00160.1.am.mk 798 RAGLRQLPLRPEIVKLVRDKVTNHYHKDFLLDEDHRWLLQGWKGRVLYAISTW 850
                                   *************************888************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098560.607452831IPR005202Transcription factor GRAS
PfamPF035149.1E-104478850IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 859 aa     Download sequence    Send to blast
MGKVELFGSV NLGGSSLCTW SGRRYHSPDS DRRSDFASWE EESLLHLVYS STVPSADPVA  60
AAVASPFRRL PGSFPLSPPS SRLQSTPEAL IFNSIHVSAH PTSATPLLLA MAATPEDILG  120
QGGYLAVPEP FSPSVFLDLP PTPRPDGGDD PASSDDLVLP FISRMLMEED IDENFFYQYP  180
DHPALLTSQQ PYAEILSAPS SSSDSATTNT TLTPSSFSDA AEPTWPYDPI ELAQLLRSPP  240
CPDEGLGLHD FTADDDSAVL FDGATPGFEQ ISMVDASPND GGEAIQSSGS WGAAEEEDTK  300
TNIAILPAAD EDHDALASAF FGGHRAVNMD MLNRAFAKGM EEAKKFLPAN SGLFVDLDAT  360
TTEHLPTNSK PLTVCNVKKE EVVVDGLSIF RERSNGRGRK NRHHEDDLEM EIGRSSKLMM  420
QEQEDSDAQE MYREIMSFNV EEFMKRMQDL RIAKDSESEK SSRKGVRGRQ GADEVVDLRT  480
MLIHCAQALS TGDLRGANET LKQIKQHSSL TGNATERLAH CFAQGLEARL AGTGSQVYKS  540
LMSKRTSVVD YLKAYKLFMA ASCFKKVKHV FSNRTIADAV AGKSKLHIVE YGVQHGFQWP  600
GLLHFLANME GGPPEVRFTG IDLPQPGFRP AYQLEKTGER LSNCARQFHV PFKFHAIAAK  660
WETVTPEDLN IDPDEVLVVN CECYLDKLMD ETVVVDSPSP RDMVLKNIRN MRPKVFIHCV  720
VNGTFGAPFF LTRFREALFF YSAQFDMLDA TIPRDNDVRL LIERDILGRS ALNVIACEGA  780
DRVERPETYK QWQVRNNRAG LRQLPLRPEI VKLVRDKVTN HYHKDFLLDE DHRWLLQGWK  840
GRVLYAISTW VAEGSNSIF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A9e-374828508374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002450062.10.0hypothetical protein SORBIDRAFT_05g027740
TrEMBLC5Y8L20.0C5Y8L2_SORBI; Putative uncharacterized protein Sb05g027740
STRINGSb05g027740.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-150SCARECROW-like 14