PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00004.1.g00980.1.am.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family G2-like
Protein Properties Length: 438aa    MW: 48063.6 Da    PI: 5.3097
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00004.1.g00980.1.am.mkhcgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like108.53.5e-34230284155
                         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                     k+r+rWtpeLHe+Fv+av+qLGGsekAtPk +l+lmkv+gLt+ hvkSHLQkYR+
  Zpz_sc00004.1.g00980.1.am.mkhc 230 KQRMRWTPELHECFVDAVNQLGGSEKATPKGVLKLMKVDGLTIFHVKSHLQKYRT 284
                                     79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.708227287IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.0E-32228286IPR009057Homeodomain-like
SuperFamilySSF466895.91E-18229284IPR009057Homeodomain-like
TIGRFAMsTIGR015571.0E-25230284IPR006447Myb domain, plants
PfamPF002491.8E-9232283IPR001005SANT/Myb domain
PfamPF143793.2E-24313360IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 438 aa     Download sequence    Send to blast
MQKFNLMQSQ NSRVVGAMSS SLPVLPNAMK ESLPKPHNPH YLPMSRQLLN DSIPLCHGAL  60
QSTPLHPRDG VIGSPFANYC ASQNDSVSNH ERQSIVASFI SRAANVEVFQ PLSDNDIDAQ  120
TEAAWFTSSM DVLPGYTDNV AAPDNQIQSG ISAIASTEIA NQNELWEQLM NDDWKDILDA  180
TATDSQSKTM VQHSNSTASQ PAMNQPASSL SGEICPVASP PNSSNASAAK QRMRWTPELH  240
ECFVDAVNQL GGSEKATPKG VLKLMKVDGL TIFHVKSHLQ KYRTARYKPD LSEGSSEKRT  300
TTEELFFDLK TSMDLTEALR LQMDVQKRLH EQLENQRKLQ LRIEEQGKYL QMMLEKQCKS  360
TTGKVQDPES GDAAPDLSHS ADKDCGATVD QNRTGDKPGI AEPVGLKQKL AEADSDPQAA  420
ADDGVSTSQE KRRKLQDS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A9e-31229288160Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B9e-31229288160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A9e-31229288160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C9e-31229288160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D9e-31229288160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F9e-31229288160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H9e-31229288160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J9e-31229288160Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in phosphate starvation signaling. Binds to P1BS, an imperfect palindromic sequence 5'-GNATATNC-3', to promote the expression of inorganic phosphate (Pi) starvation-responsive genes. Functionally redundant with PHR2 and PHR3 in regulating Pi starvation response and Pi homeostasis. {ECO:0000250|UniProtKB:Q10LZ1}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc00004.1.g00980.1.am.mkhc
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025794590.10.0protein PHOSPHATE STARVATION RESPONSE 1-like isoform X1
RefseqXP_025794591.10.0protein PHOSPHATE STARVATION RESPONSE 1-like isoform X1
SwissprotB8ANX91e-167PHR1_ORYSI; Protein PHOSPHATE STARVATION RESPONSE 1
TrEMBLA0A2S3IR130.0A0A2S3IR13_9POAL; Uncharacterized protein
TrEMBLA0A2T7CD290.0A0A2T7CD29_9POAL; Uncharacterized protein
STRINGSi035682m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19713789
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28610.15e-66phosphate starvation response 1