PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00001.1.g02480.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family LBD
Protein Properties Length: 261aa    MW: 28058.6 Da    PI: 7.1002
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00001.1.g02480.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26065.51.3e-2053102150
                        DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalp 50 
                                   +CaaCk+lrr+Ca++Cvlapyfp ++p+kf  +h++FGasn++kll+   
  Zpz_sc00001.1.g02480.1.am.mk  53 PCAACKILRRRCADGCVLAPYFPPTEPAKFTTAHRVFGASNIIKLLQVRT 102
                                   7********************************************98644 PP

2DUF26051.62.8e-1613118645100
                        DUF260  45 llkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                                   + ++lpe+ r da+ss+vyeAear+rdPvyG++g++ +lq+q ++lk++la++++ 
  Zpz_sc00001.1.g02480.1.am.mk 131 VSQDLPESSRADAVSSMVYEAEARLRDPVYGCAGTVCRLQKQANELKVQLARAQAD 186
                                   67899**********************************************99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089119.73152187IPR004883Lateral organ boundaries, LOB
PfamPF031953.9E-2053103IPR004883Lateral organ boundaries, LOB
PfamPF031951.3E-14131184IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 261 aa     Download sequence    Send to blast
MDCSNASTGT TAEHSYRSES PPSLVSTSCS PPPPSLPAAQ LIGNVAPTVV MSPCAACKIL  60
RRRCADGCVL APYFPPTEPA KFTTAHRVFG ASNIIKLLQV RTVQSQASRA TRGHHNTYTH  120
GNVLTGAFVP VSQDLPESSR ADAVSSMVYE AEARLRDPVY GCAGTVCRLQ KQANELKVQL  180
ARAQADLLNA QAQHANLLAL VCVEVANRGD SQRQQQQPSP PLMEYGGSCS EVGNAGYQMF  240
YDDSDLLDSA TWPVHEARLW T
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A6e-345218810112LOB family transfactor Ramosa2.1
5ly0_B6e-345218810112LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc00001.1.g02480.1.am.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1370744e-79AC137074.2 Genomic sequence for Oryza sativa, Nipponbare strain, clone OSJNBb0022M22, from chromosome 3, complete sequence.
GenBankAK0725154e-79AK072515.1 Oryza sativa Japonica Group cDNA clone:J023131K07, full insert sequence.
GenBankAP0149594e-79AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
GenBankCP0126114e-79CP012611.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 3 sequence.
GenBankCT8321434e-79CT832143.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSN027J24, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004987050.21e-99LOB domain-containing protein 1
TrEMBLA0A368SSE32e-98A0A368SSE3_SETIT; Uncharacterized protein
STRINGPavir.Ib01336.1.p1e-103(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26453790
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.12e-47LOB domain-containing protein 1