PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00001.1.g02380.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 533aa    MW: 55292.8 Da    PI: 8.3909
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00001.1.g02380.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1244.8e-39153213262
                        zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                                   +e+ l+cprCds ntkfCyynnyslsqPr+fCk+CrryWtkGGalrnvPvGgg+rknk+s+
  Zpz_sc00001.1.g02380.1.am.mk 153 PEQGLRCPRCDSPNTKFCYYNNYSLSQPRHFCKTCRRYWTKGGALRNVPVGGGCRKNKRSR 213
                                   67899*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027011.3E-32155211IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.609157211IPR003851Zinc finger, Dof-type
ProDomPD0074783.0E-26157210IPR003851Zinc finger, Dof-type
PROSITE patternPS013610159195IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 533 aa     Download sequence    Send to blast
MSSEVRTVFT RGPACSYYSE RSRAANMAID RAGTDNFPPS CRGSEREAEA ERSDDAHTHE  60
TPFNKILAFF PARQETLLHR RPPGPGPSSF IRVDRATAAV RAPQAAGCCG VCCMASSTAV  120
AASGDDVVGP RNQGTGGTTP PPAPQQQPPP PPPEQGLRCP RCDSPNTKFC YYNNYSLSQP  180
RHFCKTCRRY WTKGGALRNV PVGGGCRKNK RSRSAASASA AAAAAASSRL SLNLPIEGIG  240
GASADQQAAA RLGFLGGGAP LPVVSSPIGA ASASDFHGGS AVGMMALPRF NAPAVGHYVP  300
FGEWPSAPGV DISCGGGSGN GGHAMSGGQT GAVSSSIASS IESLSFINQD LHWKLQQQRL  360
ATMFLGPPPS SGTTVHVEGA AAAPEHVGGP FLQMAGTSTM EAVPAATSWF MDSSYVLPPP  420
PATIVTTTNG NVQSGRSSAD DDNATSNNNC GSAIPAWGDM STFAMLPEGR SLPAANGIHA  480
NEGPVTDDSV CLPRFWFTGI PSAPRLASSL IAFYYSWLAR SPRHGRRLPG AHV
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc00001.1.g02380.1.am.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC5824022e-89KC582402.1 Sorghum bicolor dof5 protein (dof5) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025796800.11e-113dof zinc finger protein DOF5.7-like
TrEMBLA0A3L6SBJ51e-115A0A3L6SBJ5_PANMI; Dof zinc finger protein DOF5.7-like
STRINGSi036311m1e-111(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.13e-31TARGET OF MONOPTEROS 6