PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc12571.1.g00010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRAS
Protein Properties Length: 221aa    MW: 24044.7 Da    PI: 7.0701
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc12571.1.g00010.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS2346.5e-72122019243
                          GRAS  19 laqalLarlselaspdg.dpmqRlaayfteALaarlarsvselykalppsetsekn.sseelaalklfsevsPilkfshlt 97 
                                   +a+ +Larl  +asp+g +pm+R+aayf+eALa r++r++++l++  pp+e ++    ++ + al++++ ++Pi++f h+t
  Zmw_sc12571.1.g00010.1.am.mk   1 AANYYLARLGMIASPAGpTPMHRVAAYFAEALAIRVVRTWPHLFDVTPPRELTDGAvGDDDAVALRVLNAITPIPRFLHFT 81 
                                   5899***********************************************998887899999****************** PP

                          GRAS  98 aNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfef 178
                                    N+ +l+a++g++rvH+iDfdi+qGlQWp Llq+La+R+++p ++RiTgvg+    sk+el+ tg rL ++A++lg+ fef
  Zmw_sc12571.1.g00010.1.am.mk  82 INERLLRAFDGHDRVHVIDFDIKQGLQWPGLLQSLAARANPPSHVRITGVGE----SKQELQDTGARLGHVAASLGLAFEF 158
                                   ****************************************************....************************* PP

                          GRAS 179 nvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvve 243
                                   ++ v++rled++l++L+vk gE++aVn+vl++hrll ++  ++    ++L l +s+ + ++ + e
  Zmw_sc12571.1.g00010.1.am.mk 159 HA-VVDRLEDVRLWMLHVKGGECVAVNCVLAVHRLLCNENGTA--LADFLGLARSTGAAILLLGE 220
                                   **.7*******************************95544444..589************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF035142.3E-691220IPR005202Transcription factor GRAS
PROSITE profilePS5098539.5091221IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 221 aa     Download sequence    Send to blast
AANYYLARLG MIASPAGPTP MHRVAAYFAE ALAIRVVRTW PHLFDVTPPR ELTDGAVGDD  60
DAVALRVLNA ITPIPRFLHF TINERLLRAF DGHDRVHVID FDIKQGLQWP GLLQSLAARA  120
NPPSHVRITG VGESKQELQD TGARLGHVAA SLGLAFEFHA VVDRLEDVRL WMLHVKGGEC  180
VAVNCVLAVH RLLCNENGTA LADFLGLARS TGAAILLLGE R
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-23622026241GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004964401.11e-138PREDICTED: scarecrow-like protein 28
SwissprotQ9CAN34e-95SCL28_ARATH; Scarecrow-like protein 28
TrEMBLK3Y2011e-138K3Y201_SETIT; Uncharacterized protein
STRINGSi008220m1e-138(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64043455