PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc12571.1.g00010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRAS
Protein Properties Length: 221aa    MW: 24044.7 Da    PI: 7.0701
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc12571.1.g00010.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS2346.5e-72122019243
                          GRAS  19 laqalLarlselaspdg.dpmqRlaayfteALaarlarsvselykalppsetsekn.sseelaalklfsevsPilkfshlt 97 
                                   +a+ +Larl  +asp+g +pm+R+aayf+eALa r++r++++l++  pp+e ++    ++ + al++++ ++Pi++f h+t
  Zmw_sc12571.1.g00010.1.am.mk   1 AANYYLARLGMIASPAGpTPMHRVAAYFAEALAIRVVRTWPHLFDVTPPRELTDGAvGDDDAVALRVLNAITPIPRFLHFT 81 
                                   5899***********************************************998887899999****************** PP

                          GRAS  98 aNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfef 178
                                    N+ +l+a++g++rvH+iDfdi+qGlQWp Llq+La+R+++p ++RiTgvg+    sk+el+ tg rL ++A++lg+ fef
  Zmw_sc12571.1.g00010.1.am.mk  82 INERLLRAFDGHDRVHVIDFDIKQGLQWPGLLQSLAARANPPSHVRITGVGE----SKQELQDTGARLGHVAASLGLAFEF 158
                                   ****************************************************....************************* PP

                          GRAS 179 nvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvve 243
                                   ++ v++rled++l++L+vk gE++aVn+vl++hrll ++  ++    ++L l +s+ + ++ + e
  Zmw_sc12571.1.g00010.1.am.mk 159 HA-VVDRLEDVRLWMLHVKGGECVAVNCVLAVHRLLCNENGTA--LADFLGLARSTGAAILLLGE 220
                                   **.7*******************************95544444..589************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF035142.3E-691220IPR005202Transcription factor GRAS
PROSITE profilePS5098539.5091221IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 221 aa     Download sequence    Send to blast
AANYYLARLG MIASPAGPTP MHRVAAYFAE ALAIRVVRTW PHLFDVTPPR ELTDGAVGDD  60
DAVALRVLNA ITPIPRFLHF TINERLLRAF DGHDRVHVID FDIKQGLQWP GLLQSLAARA  120
NPPSHVRITG VGESKQELQD TGARLGHVAA SLGLAFEFHA VVDRLEDVRL WMLHVKGGEC  180
VAVNCVLAVH RLLCNENGTA LADFLGLARS TGAAILLLGE R
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A2e-37218438218Protein SCARECROW
5b3h_A2e-37218437217Protein SCARECROW
5b3h_D2e-37218437217Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that acts as positivie regulator of brassinosteroid (BR) signaling (PubMed:19220793, PubMed:22685166). Functions downstream of BRI1 and GSK2 to modulate BR responses. Acts as a direct target of GSK2 kinase to mediate BR responses (PubMed:22685166). Involved in feedback inhibition of BR biosynthetic genes. Repressed by BZR1 (PubMed:19220793). {ECO:0000269|PubMed:19220793, ECO:0000269|PubMed:22685166}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Down-regulated by 24-epibrassinolide. {ECO:0000269|PubMed:19220793}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025812393.11e-139protein DWARF AND LOW-TILLERING
SwissprotQ9LWU91e-115DLT_ORYSJ; Protein DWARF AND LOW-TILLERING
TrEMBLA0A3L6PBC21e-137A0A3L6PBC2_PANMI; Scarecrow-like protein 28
TrEMBLA0A3L6RY241e-137A0A3L6RY24_PANMI; Scarecrow-like protein 28
STRINGSi008220m1e-138(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64043455
Publications ? help Back to Top
  1. Tong H,Chu C
    Roles of DLT in fine modulation on brassinosteroid response in rice.
    Plant Signal Behav, 2009. 4(5): p. 438-9
    [PMID:19816111]
  2. Li W, et al.
    Identification and characterization of dwarf 62, a loss-of-function mutation in DLT/OsGRAS-32 affecting gibberellin metabolism in rice.
    Planta, 2010. 232(6): p. 1383-96
    [PMID:20830595]
  3. Tong H, et al.
    DWARF AND LOW-TILLERING acts as a direct downstream target of a GSK3/SHAGGY-like kinase to mediate brassinosteroid responses in rice.
    Plant Cell, 2012. 24(6): p. 2562-77
    [PMID:22685166]
  4. Zhang C,Bai MY,Chong K
    Brassinosteroid-mediated regulation of agronomic traits in rice.
    Plant Cell Rep., 2014. 33(5): p. 683-96
    [PMID:24667992]
  5. Yang C,Shen W,He Y,Tian Z,Li J
    OVATE Family Protein 8 Positively Mediates Brassinosteroid Signaling through Interacting with the GSK3-like Kinase in Rice.
    PLoS Genet., 2016. 12(6): p. e1006118
    [PMID:27332964]