PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc12461.1.g00010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family TCP
Protein Properties Length: 157aa    MW: 16550.6 Da    PI: 6.3549
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc12461.1.g00010.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP99.36.9e-3163130673
                           TCP   6 drhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssasec 73 
                                    rh ++hTkv+gR+RR+Rl   caar+  L++eLG++ d++t+ WLlqq++pa++++tgt++ +a ++
  Zmw_sc12461.1.g00010.1.am.mk  63 PRHRDRHTKVEGRGRRIRLAEACAARIARLTRELGHKNDGETVRWLLQQSEPAVIAATGTGTVPAIAT 130
                                   69**********************************************************77777333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036345.4E-2565132IPR005333Transcription factor, TCP
PROSITE profilePS5136921.5265119IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 157 aa     Download sequence    Send to blast
MGEEDVAAIY HAAGNGTAVT DEAVVGIDAM GSSEAHGSLM PKPEPAPMEF LGELQVANPR  60
PAPRHRDRHT KVEGRGRRIR LAEACAARIA RLTRELGHKN DGETVRWLLQ QSEPAVIAAT  120
GTGTVPAIAT TVDGVLRLPS SPPAAVADGD QQPDPKR
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator. Binds the promoter core sequence 5'-GGNCC-3', especially at sites IIa (5'-GGGCCCAC-3') and IIb (5'-GGTCCCAC-3') (essential for meristematic tissue-specificity expression) of the PCNA gene promoter. {ECO:0000269|PubMed:12000681}.
UniProtTranscription activator. Binds the promoter core sequence 5'-GGNCC-3', especially at sites IIa (5'-GGGCCCAC-3') and IIb (5'-GGTCCCAC-3') (essential for meristematic tissue-specificity expression) of the PCNA gene promoter. {ECO:0000269|PubMed:12000681, ECO:0000269|PubMed:9338963}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025803340.15e-64transcription factor PCF2-like
SwissprotA2YXQ11e-46PCF2_ORYSI; Transcription factor PCF2
SwissprotQ6ZBH61e-46PCF2_ORYSJ; Transcription factor PCF2
TrEMBLA0A3L6QPY73e-65A0A3L6QPY7_PANMI; Transcription factor PCF2-like
STRINGSi030591m2e-61(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP39123167
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]