PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc11456.1.g00010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 314aa    MW: 34803.7 Da    PI: 4.5049
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc11456.1.g00010.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM31.84.1e-10412914128
                           NAM  14 lvveyLkkkvegkkleleevikevdiykvePwdLpk..........kvkaeekewyfFskrdkkyatgkrknra....tks 80 
                                   lv + L++k+++++++ +  +++ d++++ P++L +          + +++  ++yfFs+++   a+ ++++r+     k+
  Zmw_sc11456.1.g00010.1.am.mk   4 LV-DSLRAKIANQEIPHAVYFRDDDVCSLRPEELVRrhgkparvnpREAGDGLQYYFFSPAHFVGASRTKRSRIiggtEKK 83 
                                   55.669********999667**************744677775543222234488*****999988888778864554447 PP

                           NAM  81 gyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                    +W+a  + k+v      +  +   L ++ +  +  +k  W+m ey++
  Zmw_sc11456.1.g00010.1.am.mk  84 ETWHAETSLKQVEG--AVDGFMMVKLSYHVKIGEIVQKPGWLMTEYSF 129
                                   88******999977..6667788889***88888899*********86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100512.0531143IPR003441NAC domain
PfamPF023653.5E-54128IPR003441NAC domain
SuperFamilySSF1019412.75E-128143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
DARLVDSLRA KIANQEIPHA VYFRDDDVCS LRPEELVRRH GKPARVNPRE AGDGLQYYFF  60
SPAHFVGASR TKRSRIIGGT EKKETWHAET SLKQVEGAVD GFMMVKLSYH VKIGEIVQKP  120
GWLMTEYSFK GAGDTVLCKI YKSPRGPGRS KAPSSSSAGK RKAEDDLEGE TSSMRQRHEN  180
VAAPEFAEHV EESQPEPQIA PATFEFDGNI TFTLEELTNF PTGDVHTGFG ALTDGEVIAA  240
YASGGTVDEL IPSTMEEVQP ESEVPPASTD DSMTFEELWQ LLDTDIVDDG AYLQLPADEI  300
LAEEWLKDKE TLQH
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62801545