PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc11006.1.g00010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRAS
Protein Properties Length: 399aa    MW: 41517.9 Da    PI: 6.5807
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc11006.1.g00010.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS214.36.5e-661293992274
                          GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn..sseelaa 80 
                                   ++lL ++A av++g+++ a a La l+  a+p+gd+ qRl+a++t AL++r+           p+s+    +    e+ aa
  Zmw_sc11006.1.g00010.1.am.mk 129 RQLLSDAAAAVADGNQTVAAAHLAVLKISANPRGDAEQRLVAMMTGALSSRVGP---------PSSQHLV-DlcGGEQRAA 199
                                   6899*************************************************9.........2222222.2236667789 PP

                          GRAS  81 lklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg........ 153
                                    +l+++vsP++ ++   aN aIl+av+ ++++H++Dfdis  +Q +aL+qaL +R++   sl+iT+v++p+s         
  Zmw_sc11006.1.g00010.1.am.mk 200 CQLLHDVSPCFGLALHGANLAILDAVADHRAIHVVDFDISI-AQHIALIQALGNRRAAGTSLKITAVADPTSPftspftpa 279
                                   9**************************************97.79*************************998889999999 PP

                          GRAS 154 skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvksl 234
                                    +++l +t erL++ A++ gv+f+f++ v+ + +++e ++L ++pgEalaVnl++ l r++desvs +++rde+L+ v+ l
  Zmw_sc11006.1.g00010.1.am.mk 280 LAQALASTTERLKRHAQQAGVEFRFKA-VSCSAAEIEASRLGCQPGEALAVNLAFILSRVPDESVSPANPRDELLRRVRAL 359
                                   999************************.6889999********************************************** PP

                          GRAS 235 sPkvvvvveqeadhnsesFlerflealeyysalfdsleak 274
                                    P+vv++veqe+++n++++++rf++a+ +y a+++sl+a+
  Zmw_sc11006.1.g00010.1.am.mk 360 GPRVVTLVEQELNTNTAPLAARFADACAHYGAVLESLDAT 399
                                   *************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098537.162102399IPR005202Transcription factor GRAS
PfamPF035142.2E-63129399IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 399 aa     Download sequence    Send to blast
MQPLWQRQVM AAPSAPVAKG AAATARPTTA REMVLLRELE KQLLGDDEEV EAEAAGSVCG  60
SAVTNSGWGE TIHELNSIAA TPLPSHPKTM TATNRYNTVP MSRSPSNSTS SATSSTASSS  120
PPTSAASSRQ LLSDAAAAVA DGNQTVAAAH LAVLKISANP RGDAEQRLVA MMTGALSSRV  180
GPPSSQHLVD LCGGEQRAAC QLLHDVSPCF GLALHGANLA ILDAVADHRA IHVVDFDISI  240
AQHIALIQAL GNRRAAGTSL KITAVADPTS PFTSPFTPAL AQALASTTER LKRHAQQAGV  300
EFRFKAVSCS AAEIEASRLG CQPGEALAVN LAFILSRVPD ESVSPANPRD ELLRRVRALG  360
PRVVTLVEQE LNTNTAPLAA RFADACAHYG AVLESLDAT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-291243971270GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004953458.11e-172PREDICTED: scarecrow-like protein 8
TrEMBLA0A0A9FCJ70.0A0A0A9FCJ7_ARUDO; Uncharacterized protein
STRINGSi016627m1e-172(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP41883474