PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc10841.1.g00010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRAS
Protein Properties Length: 459aa    MW: 47348.4 Da    PI: 7.3584
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc10841.1.g00010.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS215.72.5e-661934592274
                          GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn..sseelaa 80 
                                   ++lL ++A av++g+++ a a La l+  a+p+gd+ qRl+a++t AL++r+           p+s+    +    e+ aa
  Zmw_sc10841.1.g00010.1.am.mk 193 RQLLSDAAAAVADGNQTVAAAHLAVLKISANPRGDAEQRLVAMMTGALSSRVGP---------PSSQHLV-DlcGGEQRAA 263
                                   6899*************************************************9.........2222222.2236667789 PP

                          GRAS  81 lklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg....skee 157
                                    +l+++vsP++ ++   aN aIl+av+ ++++H++Dfd+s  +Q +aL+qaL +R++   sl+iT+v++p+s      +++
  Zmw_sc10841.1.g00010.1.am.mk 264 CQLLHDVSPCFGLALHGANLAILDAVADHRAIHVVDFDVSI-AQHIALIQALGNRRAAGTSLKITAVADPTSPftpaLAQA 343
                                   9**************************************97.79*************************9988899999** PP

                          GRAS 158 leetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkv 238
                                   l +t erL++ A++ gv+f+f++ v+ + +++e ++L ++pgEalaVnl++ l r++desvs +++rde+L+ v+ l P+v
  Zmw_sc10841.1.g00010.1.am.mk 344 LASTTERLKRHAQQAGVEFRFKA-VSCSAAEIEASRLGCQPGEALAVNLAFFLSRVPDESVSPANPRDELLRRVRALGPRV 423
                                   ***********************.6889999************************************************** PP

                          GRAS 239 vvvveqeadhnsesFlerflealeyysalfdsleak 274
                                   v++veqe+++n++++++rf++a+ +y a+++sl+a+
  Zmw_sc10841.1.g00010.1.am.mk 424 VTLVEQELNTNTAPLAARFADACAHYGAVLESLDAT 459
                                   *********************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098537.418166459IPR005202Transcription factor GRAS
PfamPF035148.6E-64193459IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 459 aa     Download sequence    Send to blast
CLRAVKQRTA APVPPGHHQL DIGAVLAGAA SARARGLSGQ PSAGFAGPSP QPSSTLSSLT  60
TASPMQQLWQ RQVMAAPSAP VAKGAAATAR PTTAREMVLL RELEKQLLGD DEEVEAEAAG  120
SVCGSAVTNS GWGETIHELN SIAATPLPSH PKTMTATNRY NTVPMSRSPS NSTSSATSST  180
ASSSPPTSAA SSRQLLSDAA AAVADGNQTV AAAHLAVLKI SANPRGDAEQ RLVAMMTGAL  240
SSRVGPPSSQ HLVDLCGGEQ RAACQLLHDV SPCFGLALHG ANLAILDAVA DHRAIHVVDF  300
DVSIAQHIAL IQALGNRRAA GTSLKITAVA DPTSPFTPAL AQALASTTER LKRHAQQAGV  360
EFRFKAVSCS AAEIEASRLG CQPGEALAVN LAFFLSRVPD ESVSPANPRD ELLRRVRALG  420
PRVVTLVEQE LNTNTAPLAA RFADACAHYG AVLESLDAT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-281884571270GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004953458.10.0PREDICTED: scarecrow-like protein 8
TrEMBLA0A0A9FCJ70.0A0A0A9FCJ7_ARUDO; Uncharacterized protein
STRINGSi016627m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP41883474