PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc10776.1.g00010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family LBD
Protein Properties Length: 62aa    MW: 6382.39 Da    PI: 9.0464
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc10776.1.g00010.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26049.31.4e-152862135
                        DUF260  1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhk 35
                                  +CaaCk+lrrkC ++Cv+apyfp e+p+kfanvhk
  Zmw_sc10776.1.g00010.1.sm.mk 28 PCAACKFLRRKCLPGCVFAPYFPPEEPQKFANVHK 62
                                  7*********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089114.662762IPR004883Lateral organ boundaries, LOB
PfamPF031954.0E-142862IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 62 aa     Download sequence    Send to blast
MASPSSTSNS AMSPVAAPGT TTPGAGAPCA ACKFLRRKCL PGCVFAPYFP PEEPQKFANV  60
HK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-252162445LOB family transfactor Ramosa2.1
5ly0_B2e-252162445LOB family transfactor Ramosa2.1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtNot known; ectopic expression of LOB leads to alterations in the size and shape of leaves and floral organs and causes male and female sterility.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Positively regulated within the shoot apex by both ASYMMETRIC LEAVES 1 (AS1) and ASYMMETRIC LEAVES 2 (AS2/LBD6) and by KNAT1. {ECO:0000269|PubMed:11934861}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025818403.14e-34protein LATERAL ORGAN BOUNDARIES-like
RefseqXP_025818404.14e-34protein LATERAL ORGAN BOUNDARIES-like
SwissprotQ9FML45e-19LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES
TrEMBLA0A2S3HY849e-33A0A2S3HY84_9POAL; Uncharacterized protein
TrEMBLA0A2T7DRP89e-33A0A2T7DRP8_9POAL; Uncharacterized protein
TrEMBLA0A3L6SKA69e-33A0A3L6SKA6_PANMI; LOB domain-containing protein 4-like
STRINGPavir.J38993.1.p5e-33(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP88133545
Publications ? help Back to Top
  1. Xu C, et al.
    Control of auxin-induced callus formation by bZIP59-LBD complex in Arabidopsis regeneration.
    Nat Plants, 2018. 4(2): p. 108-115
    [PMID:29358751]
  2. Liu J, et al.
    The WOX11-LBD16 Pathway Promotes Pluripotency Acquisition in Callus Cells During De Novo Shoot Regeneration in Tissue Culture.
    Plant Cell Physiol., 2018. 59(4): p. 734-743
    [PMID:29361138]