PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc08391.1.g00030.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRAS
Protein Properties Length: 316aa    MW: 36654.4 Da    PI: 9.4839
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc08391.1.g00030.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS294.72.4e-90631464373
                            GRAS  64 lppsetseknsseelaalklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppsl 142
                                     l +++ts    +  l+a++l+  +  + k++++  N +I++a  g++++Hi+D++i +G+QWp++l+ +++R++gpp++
  Zmw_sc08391.1.g00030.1.es.mkhc   6 LMAKRTS---AVALLQAYQLYMAAICFKKVAFIFSNYTIYNASLGKKKIHIVDYGIRYGFQWPCFLRRISCREGGPPEV 81 
                                     4444444...889999*************************************************************** PP

                            GRAS 143 RiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvs 219
                                     RiTg++ p++g   +e++eetg+rL ++A+e+gvpf++++++a+++e+++ e+L+++p+E+l+Vn+++q  +l+desv 
  Zmw_sc08391.1.g00030.1.es.mkhc  82 RITGIDLPQPGfrPTERIEETGRRLGNYAREFGVPFKYHAIAASKMESIRKEDLNIDPDEVLIVNCMYQFRNLMDESVV 160
                                     **********9******************************************************************** PP

                            GRAS 220 leserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvv 298
                                     +es+rd vL+ +++++P+ ++++  + + +++ F++rf eal yysalfd l+++ pr+s++r+ +E+ ++gr + nv+
  Zmw_sc08391.1.g00030.1.es.mkhc 161 IESPRDVVLNNIRKMQPHAFIHAIVNGSFSAPFFVTRFREALFYYSALFDILDTTTPRNSDQRMLIEQNIFGRIALNVI 239
                                     ******************************************************************************* PP

                            GRAS 299 acegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                                     aceg++r+er et+++W+ r ++aG+k++pl++++++ +++ ++ ++ + + ++ ++++l++gWk+r L+++S W
  Zmw_sc08391.1.g00030.1.es.mkhc 240 ACEGTDRVERPETYKQWQVRNQRAGLKQLPLNQEIVQVVRSKVKDCYHKDFVIDVDHNWLLQGWKGRVLYAISTW 314
                                     ***********************************************889************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098551.3091295IPR005202Transcription factor GRAS
PfamPF035148.2E-886314IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MVYQSLMAKR TSAVALLQAY QLYMAAICFK KVAFIFSNYT IYNASLGKKK IHIVDYGIRY  60
GFQWPCFLRR ISCREGGPPE VRITGIDLPQ PGFRPTERIE ETGRRLGNYA REFGVPFKYH  120
AIAASKMESI RKEDLNIDPD EVLIVNCMYQ FRNLMDESVV IESPRDVVLN NIRKMQPHAF  180
IHAIVNGSFS APFFVTRFRE ALFYYSALFD ILDTTTPRNS DQRMLIEQNI FGRIALNVIA  240
CEGTDRVERP ETYKQWQVRN QRAGLKQLPL NQEIVQVVRS KVKDCYHKDF VIDVDHNWLL  300
QGWKGRVLYA ISTWGG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-382031480374GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015620149.10.0PREDICTED: scarecrow-like protein 34
SwissprotO809331e-124SCL9_ARATH; Scarecrow-like protein 9
TrEMBLA0A0A9UN520.0A0A0A9UN52_ARUDO; Uncharacterized protein
STRINGBGIOSGA037646-PA0.0(Oryza sativa Indica Group)
STRINGORGLA12G0145700.10.0(Oryza glaberrima)
STRINGORGLA12G0207400.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297