PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc08116.1.g00010.1
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 377aa    MW: 42109.3 Da    PI: 8.7761
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
                           NAM   1 lppGfrFhPtdeelvveyLkkkvegkk.leleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratks 80 
                                   lppGfrF Pt+eelv++yL+ k++g++  ++e+vi+ +d++ ++Pw+Lp +  ++ + w++F++r++++a+g r++r+t s 216 LPPGFRFYPTEEELVCFYLRSKLDGRRrDDIERVIPVADVCALDPWQLPGT--SSGEPWFYFCRRQEREARGGRPSRTTPS 294
                                   79***********************996667778***************43..46799*********************** PP

                           NAM  81 gyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                   g+Wka g+   v++++g+ +g+kkt+vfy+grap g+kt+W m+eyr+ 295 GFWKAAGTPGWVYAADGRPIGTKKTMVFYRGRAPAGTKTKWKMNEYRA 342
                                   **********************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.54E-49211369IPR003441NAC domain
PROSITE profilePS5100547.864216369IPR003441NAC domain
PfamPF023652.1E-23217341IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 377 aa     Download sequence    Send to blast
3D Structure ? help Back to Top
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A5e-3021636917165NO APICAL MERISTEM PROTEIN
1ut4_B5e-3021636917165NO APICAL MERISTEM PROTEIN
1ut7_A5e-3021636917165NO APICAL MERISTEM PROTEIN
1ut7_B5e-3021636917165NO APICAL MERISTEM PROTEIN
3swm_A6e-3021636920168NAC domain-containing protein 19
3swm_B6e-3021636920168NAC domain-containing protein 19
3swm_C6e-3021636920168NAC domain-containing protein 19
3swm_D6e-3021636920168NAC domain-containing protein 19
3swp_A6e-3021636920168NAC domain-containing protein 19
3swp_B6e-3021636920168NAC domain-containing protein 19
3swp_C6e-3021636920168NAC domain-containing protein 19
3swp_D6e-3021636920168NAC domain-containing protein 19
4dul_A5e-3021636917165NAC domain-containing protein 19
4dul_B5e-3021636917165NAC domain-containing protein 19
Nucleic Localization Signal ? help Back to Top
No. Start End Sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGPavir.J36282.1.p7e-93(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number