PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc07654.1.g00020.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 97aa    MW: 11264.6 Da    PI: 6.254
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc07654.1.g00020.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM55.81.6e-172994167
                           NAM  1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkk 67
                                  lppGfrFhPtdee+++ yL++kv ++++++  +i e+d++k+e w+Lp + + +ek  +f+ +r+k+
  Zmw_sc07654.1.g00020.1.sm.mk 29 LPPGFRFHPTDEEIINSYLRAKVLDNNFTA-LAIGEADLNKSELWELPLMENMGEKVGHFYYQRNKQ 94
                                  79*************************999.67***************5555566777999999886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.41E-182695IPR003441NAC domain
PROSITE profilePS5100519.5422997IPR003441NAC domain
PfamPF023655.2E-83073IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 97 aa     Download sequence    Send to blast
MDNRKRTTLE KLHREASKGF NGDGNGLDLP PGFRFHPTDE EIINSYLRAK VLDNNFTALA  60
IGEADLNKSE LWELPLMENM GEKVGHFYYQ RNKQWPQ
Functional Description ? help Back to Top
Source Description
UniProtBinds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by the microRNA miR164. {ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:17098808}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018473507.12e-27PREDICTED: NAC domain-containing protein 79-like
SwissprotQ9FLJ23e-27NC100_ARATH; NAC domain-containing protein 100
TrEMBLA0A0D3B1S35e-25A0A0D3B1S3_BRAOL; Uncharacterized protein
TrEMBLA0A178USB87e-25A0A178USB8_ARATH; NAC100
TrEMBLA0A2I0L9H94e-25A0A2I0L9H9_PUNGR; Uncharacterized protein
TrEMBLA0A397ZUK56e-25A0A397ZUK5_BRACM; Uncharacterized protein
TrEMBLA0A3N6RC445e-25A0A3N6RC44_BRACR; Uncharacterized protein (Fragment)
TrEMBLM4CQG06e-25M4CQG0_BRARP; Uncharacterized protein
STRINGLus100268798e-26(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2554155
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]