PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc07544.1.g00010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bZIP
Protein Properties Length: 147aa    MW: 16104.6 Da    PI: 7.1965
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc07544.1.g00010.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_128.63.2e-09117146433
                                   XCHHHCHHHHHHHHHHHHHHHHHHHHHHHH CS
                        bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLee 33 
                                    kr rr+ +NRe+Arr R RK+a+++eLe 
  Zmw_sc07544.1.g00010.1.sm.mk 117 TKRIRRMVSNRESARRTRWRKQAQLAELES 146
                                   69**************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS502178.508116147IPR004827Basic-leucine zipper domain
PfamPF001705.7E-7117146IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.3E-5118147No hitNo description
SuperFamilySSF579592.59E-6118147No hitNo description
CDDcd147021.49E-10119147No hitNo description
PROSITE patternPS000360121136IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 147 aa     Download sequence    Send to blast
MKNCASELQL EAFIREDAAA GRNEQSCRPL NGGFGFGDQN AMDGSSDENP WWSGSIRTPE  60
PASSSSVEWQ RAVISAASTS GTSSTNHGNE SQSGSNSESL IDVEGVPCER SIKPLKTKRI  120
RRMVSNRESA RRTRWRKQAQ LAELESQ
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1130137RRTRWRKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that binds to the DNA specific sequence 5'-TGAGTCA-3' found in seed storage protein gene promoters. {ECO:0000269|PubMed:11133985}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004951741.17e-31bZIP transcription factor RISBZ4 isoform X2
SwissprotQ6H5003e-27RSBZ4_ORYSJ; bZIP transcription factor RISBZ4
TrEMBLA0A0E0CGG23e-31A0A0E0CGG2_9ORYZ; Uncharacterized protein
STRINGOMERI02G06430.24e-32(Oryza meridionalis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP5754922
Publications ? help Back to Top
  1. Onodera Y,Suzuki A,Wu CY,Washida H,Takaiwa F
    A rice functional transcriptional activator, RISBZ1, responsible for endosperm-specific expression of storage protein genes through GCN4 motif.
    J. Biol. Chem., 2001. 276(17): p. 14139-52
    [PMID:11133985]
  2. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]