PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc07514.1.g00060.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 361aa    MW: 39085.9 Da    PI: 6.5726
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc07514.1.g00060.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM171.82.1e-53131391129
                             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratk 79 
                                     lppGfrFhPtdeel+++yL +k+++ ++ + +++ e+d++k+ePwdLp+++k +ekewyfF+ +d+ky+tg r+nrat+
  Zmw_sc07514.1.g00060.1.sm.mkhc  13 LPPGFRFHPTDEELITQYLGRKAADPRFAA-RAVGEADLNKCEPWDLPSRAKWGEKEWYFFCVKDRKYPTGLRTNRATE 90 
                                     79*************************999.88***************99999************************** PP

                             NAM  80 sgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                                     sgyWkatgkd+e+++ ++ lvg+kktLvfy+grapkg +t Wvmheyrle
  Zmw_sc07514.1.g00060.1.sm.mkhc  91 SGYWKATGKDREIFR-GKVLVGMKKTLVFYTGRAPKGGNTGWVMHEYRLE 139
                                     ***************.99******************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.71E-628174IPR003441NAC domain
PROSITE profilePS5100557.40613174IPR003441NAC domain
PfamPF023652.5E-2814138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 361 aa     Download sequence    Send to blast
MELDVHHHQD MDLPPGFRFH PTDEELITQY LGRKAADPRF AARAVGEADL NKCEPWDLPS  60
RAKWGEKEWY FFCVKDRKYP TGLRTNRATE SGYWKATGKD REIFRGKVLV GMKKTLVFYT  120
GRAPKGGNTG WVMHEYRLEE KRVTNGGAGS GNVFLSSTAA TSKDEWVLCR VFKKNIERPT  180
VAGGKRSGSS SFMETADACP SISVADELAA ACALPPLMDV STVSGGVHMS LSAAAAIELL  240
PPPAHVTCFS NALESPFLNP PFIAPSATAP ASAAAHGAAV AADHFAVASP SPFLQMQYEG  300
AAGGLVQELL LHEGGGWYSK HGERERLSGA SQDTGVTSEV NPAETSSSRE HMNHEASLWD  360
Y
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-561117515166NO APICAL MERISTEM PROTEIN
1ut4_B1e-561117515166NO APICAL MERISTEM PROTEIN
1ut7_A1e-561117515166NO APICAL MERISTEM PROTEIN
1ut7_B1e-561117515166NO APICAL MERISTEM PROTEIN
3swm_A1e-561117518169NAC domain-containing protein 19
3swm_B1e-561117518169NAC domain-containing protein 19
3swm_C1e-561117518169NAC domain-containing protein 19
3swm_D1e-561117518169NAC domain-containing protein 19
3swp_A1e-561117518169NAC domain-containing protein 19
3swp_B1e-561117518169NAC domain-containing protein 19
3swp_C1e-561117518169NAC domain-containing protein 19
3swp_D1e-561117518169NAC domain-containing protein 19
4dul_A1e-561117515166NAC domain-containing protein 19
4dul_B1e-561117515166NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004952889.11e-165NAC domain-containing protein 92
RefseqXP_022679460.11e-165NAC domain-containing protein 92
TrEMBLK3YTH51e-163K3YTH5_SETIT; Uncharacterized protein
STRINGSi017567m1e-164(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP27303787