PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc07459.1.g00020.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 656aa    MW: 73381.1 Da    PI: 10.6741
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc07459.1.g00020.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.81.8e-523644911128
                           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksg 81 
                                   lppGfrFhPtdeelvv+yL++kv++++l++  +i+evd+yk++PwdLp+k+  ++kewyfF++rd+ky++g+r+nra+ +g
  Zmw_sc07459.1.g00020.1.am.mk 364 LPPGFRFHPTDEELVVHYLCRKVARQQLPV-PIIAEVDLYKFDPWDLPEKALFGHKEWYFFTPRDRKYPNGSRPNRAAGRG 443
                                   79****************************.88***************8888899************************** PP

                           NAM  82 yWkatgkdkevlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                                   yWkatg dk++  k + ++ g+kk Lvfy+g+ap+g+ktdW+mheyr+
  Zmw_sc07459.1.g00020.1.am.mk 444 YWKATGADKPIAPKgSAKAAGIKKALVFYSGKAPRGVKTDWIMHEYRV 491
                                   ************99666779**************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-61360517IPR003441NAC domain
PROSITE profilePS5100560.665364517IPR003441NAC domain
PfamPF023651.2E-26365491IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 656 aa     Download sequence    Send to blast
MSFSDLQARG RSLQTTRKTD TRVGVSAVGT AGHPTWCDDS VRPRTGINET GWVRPAPRTH  60
GRGDAFVLEE QIIRWLVAGV RACVTPSFLL QIISLPWIRL PLDSRYDPSI VRRFHSQFHA  120
IGHSPPPAEP ERHPAVDGSG LTTNPARRIC LPRTVAARPG STHAPRGWGR QAGTGHVLNG  180
KHFFFTGKRR WTNLGLDSDA RATIRTWCQP KPSLEPQAGS PARRAESENI EFSRRPRAVP  240
FVEIAEPFDP TPRRRAPQVR PISTREPSRQ RRPCSSAAHA ARADRGAQAA RAHINGADPA  300
SLAAKETALY HPAAVRNQTN RTRGRRGVLT GRGRGRFRSR VVLRRMAMAA QASGRRDVEA  360
ELNLPPGFRF HPTDEELVVH YLCRKVARQQ LPVPIIAEVD LYKFDPWDLP EKALFGHKEW  420
YFFTPRDRKY PNGSRPNRAA GRGYWKATGA DKPIAPKGSA KAAGIKKALV FYSGKAPRGV  480
KTDWIMHEYR VADIDRAPGK KGSQKLDEWV LCRLYNKKNN WEKLKVEELQ DQMAAAHHRH  540
KEESMDVLAD TMSDSFQTHD SDIDNASGMQ QNSFGDMAQG QTTMPNGMVT VKEDSDWFTD  600
VNFDELQASY MNIGQMVNPN LGQMVNPAAG QECHAGYLQS IGAPQMRMWQ TILPPF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A6e-903565237174Stress-induced transcription factor NAC1
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP53893761