PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc07410.1.g00010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family SBP
Protein Properties Length: 429aa    MW: 45926.9 Da    PI: 6.1952
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc07410.1.g00010.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP113.11.6e-35226301176
                                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS
                             SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76 
                                     +Cqv+gCead+ e+k yhrrh+vC  +++a++vl++g+++r+CqqC++fh l +fDe+krsCrr+L++hn+rrr+k
  Zmw_sc07410.1.g00010.1.am.mkhc 226 RCQVPGCEADIRELKGYHRRHRVCLRCAHAAAVLLDGVQKRYCQQCGKFHVLLDFDEDKRSCRRKLERHNKRRRRK 301
                                     6************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.2E-27223288IPR004333Transcription factor, SBP-box
PROSITE profilePS5114129.615224301IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.12E-33225305IPR004333Transcription factor, SBP-box
PfamPF031103.4E-27227301IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0055070Biological Processcopper ion homeostasis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 429 aa     Download sequence    Send to blast
MWPMCGGRVL PFAPPRRACH PQPPSASLPP QNPHILGADR AMDAPYSGGG GVDAGEPVWD  60
WGNLLDFVVQ DDDSLVLPWD DVAGTGAAGP TEAGASLLAT PPPQPAEVEA NQEPEPEPEP  120
VLPPLPLHVQ GIGRRVRKRD PRLVCPNYLA GRVPCACPEV DEMAAAAEVE DVATELLAGA  180
RKKVKTAGRR GKAGAVGGAG GSGGGVSTTG GGSGGGGRAV VAAEMRCQVP GCEADIRELK  240
GYHRRHRVCL RCAHAAAVLL DGVQKRYCQQ CGKFHVLLDF DEDKRSCRRK LERHNKRRRR  300
KPDSKVPFEK EMDEHLDLSA DVSGDGELRE ENIECTTSEM LETVLSNKVL DRETPMGSED  360
VLSSPTCTQP NLQNEQSKSI VTFAASVEAS SGAKQESVKL NNSPIHDLKT AYSSSVSPFL  420
IRGTYLFII
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul5_A4e-38226305584squamosa promoter binding protein-like 7
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1283301KRSCRRKLERHNKRRRRKP
2287299RRKLERHNKRRRR
3294301NKRRRRKP
4295300KRRRRK
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00604PBMTransfer from AT5G18830Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008656292.21e-178squamosa promoter-binding-like protein 9
SwissprotQ6I5761e-164SPL9_ORYSJ; Squamosa promoter-binding-like protein 9
TrEMBLA0A1D6FQA80.0A0A1D6FQA8_MAIZE; Squamosa promoter-binding protein-like (SBP domain) transcription factor family protein
TrEMBLA0A1D6FQB00.0A0A1D6FQB0_MAIZE; Squamosa promoter-binding protein-like (SBP domain) transcription factor family protein
TrEMBLA0A1D6FQB11e-179A0A1D6FQB1_MAIZE; Squamosa promoter-binding protein-like (SBP domain) transcription factor family protein
TrEMBLA0A1D6FQB31e-179A0A1D6FQB3_MAIZE; Squamosa promoter-binding protein-like (SBP domain) transcription factor family protein
TrEMBLA0A1D6FQB40.0A0A1D6FQB4_MAIZE; Squamosa promoter-binding protein-like (SBP domain) transcription factor family protein
STRINGGRMZM2G109354_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP69223344
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Cheng CH, et al.
    A fine physical map of the rice chromosome 5.
    Mol. Genet. Genomics, 2005. 274(4): p. 337-45
    [PMID:16261349]