PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc07407.1.g00040.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Whirly
Protein Properties Length: 710aa    MW: 76839.8 Da    PI: 10.7749
Description Whirly family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc07407.1.g00040.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Whirly41.33e-13561606146
                        Whirly   1 svyktkaalkvkavrptfealdsgnlklkraGglllelanataerk 46 
                                   s+yk+kaal+ +++ p+f+ ldsg+ k+ ++G +ll++a+a+a r+
  Zmw_sc07407.1.g00040.1.am.mk 561 SIYKGKAALSFDPRPPQFVPLDSGAYKVAKEGCVLLQFAPAVASRH 606
                                   79*****************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.30.559.105.4E-273148IPR023213Chloramphenicol acetyltransferase-like domain
PfamPF024582.2E-1021144IPR003480Transferase
PfamPF024586.0E-12272394IPR003480Transferase
Gene3DG3DSA:3.30.559.101.2E-25272425IPR023213Chloramphenicol acetyltransferase-like domain
SuperFamilySSF527775.11E-5325393No hitNo description
Gene3DG3DSA:2.30.31.101.4E-19549606IPR009044ssDNA-binding transcriptional regulator
SuperFamilySSF544471.8E-15554606IPR009044ssDNA-binding transcriptional regulator
PfamPF085366.5E-12562606IPR013742Plant transcription factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006281Biological ProcessDNA repair
GO:0032211Biological Processnegative regulation of telomere maintenance via telomerase
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045910Biological Processnegative regulation of DNA recombination
GO:0009508Cellular Componentplastid chromosome
GO:0009570Cellular Componentchloroplast stroma
GO:0003697Molecular Functionsingle-stranded DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0003723Molecular FunctionRNA binding
GO:0016747Molecular Functiontransferase activity, transferring acyl groups other than amino-acyl groups
GO:0042162Molecular Functiontelomeric DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 710 aa     Download sequence    Send to blast
MSPRVRVLSV THVQPDQATG PSPRDAEHAI KLSLFDTMFV ALPMGQRLFF YERDDLPPLL  60
SLSRSLRSAL AATLAVFTPL ASKLTSTLPA SSGEVFIDCS PDGVAPGVRF VEAEYAGGDM  120
RRLAADAEHD VATFLQLVPD LPVGKLPASL AGPGLEPPTF DRAVINRHPK AEESFPTSAN  180
RNNNIAISNT TTTASHHLLN RRYFHHPQCR GNRLNAALTL PEPSPPPPQM ARTSTGHRRS  240
STQPSLTAST VHTTSATITS LCFEANGLLH ARRKTYLLTV DEIRSLKQRI SRQSSGGKTK  300
APTTHAAIAS LIWTSVVRAK NSSKNYADDD DVYLMFATDC RPRLRPPPGD TFFGNCVRSC  360
YVRATAGQLR GGRLAHAAAT VREAVRADQE DGDRLADAGR WIELYRAFSR EHVTQIEASH  420
WFAAHRLGLW LGRAEPWGAC VGVRRGVRVA ARGAGRRGAG VSTPPPPSPF GEMPPSPPLF  480
LSLPSPALMP VHLPKSAQTV SVASPFPSPR KPALPACSVS SPRHSDYFDP RAPPPPPPRG  540
NGYGRPPPNG SLDGRVFTSY SIYKGKAALS FDPRPPQFVP LDSGAYKVAK EGCVLLQFAP  600
AVASRHHRAI PPGLRKIKSW RPAEARSSCT ILPRCPTRSA AAALTTRVAE SYLCHLRRPL  660
PSPTSPLPRP RLSARGRGEG ARWWCHEAKA MAPQLAMDIM GRQQLAALAA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1l3a_A1e-145506073289p24: plant transcriptional regulator PBF-2
1l3a_B1e-145506073289p24: plant transcriptional regulator PBF-2
1l3a_C1e-145506073289p24: plant transcriptional regulator PBF-2
1l3a_D1e-145506073289p24: plant transcriptional regulator PBF-2
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP384123